KEGG   Geitlerinema sp. PCC 7407: GEI7407_2266Help
Entry
GEI7407_2266      CDS       T02366                                 

Definition
(GenBank) photosystem II protein PsbI
  KO
K02710  
photosystem II PsbI protein
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    GEI7407_2266
Photosynthesis proteins [BR:gei00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    GEI7407_2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2793559..2793675)
Genome map
AA seq 38 aa AA seqDB search
MLTLKIAVYLVVAFFVGLFVFGFLSNDPARTPNRRDME
NT seq 117 nt NT seq  +upstreamnt  +downstreamnt
atgctgactttgaaaatcgctgtttatctcgtcgttgcattttttgttggcctgttcgtc
tttggcttcctctcaaatgaccctgctcggacccccaaccgccgggatatggagtaa

DBGET integrated database retrieval system