KEGG   Geitlerinema sp. PCC 7407: GEI7407_2276Help
Entry
GEI7407_2276      CDS       T02366                                 

Definition
(GenBank) zeta-carotene desaturase
  KO
K00514  
zeta-carotene desaturase [EC:1.3.5.6]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Carotenoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    GEI7407_2276
Enzymes [BR:gei01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.6  9,9'-dicis-zeta-carotene desaturase
     GEI7407_2276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2801966..2803438
Genome map
AA seq 490 aa AA seqDB search
MRVAIVGAGLAGMATAVDLVDAGHEVEIFESRPFVGGKVGSWVDADGNHIEMGLHVFFGC
YYNLFELMKKVDAFQHLRLKEHTHTFINRGGDVGALDFRFITGAPFNGLKAFFTTSQLSL
ADKAQNAIALGISPLVRGLVDFDGAMKTIRALDHISFADWFRQHGGSDGSLKRMWNPIAY
ALGFIDTENISARCMLTIFQFFAAKTEASILRMLEGSPEEYLHRPIVNYLEERGGKIHLR
RGVRQILFEGEGDQTQVTGLVVANGDSTETITADAYVCACDVPGIQRLVPDAWRRWSEFD
NIFKLDTVPVATVQLRFDGWVTEMHDAARRRQLQEAAGIDNLLYTPDADFSCFADLALTS
PGDYYREGQGSLMQLVLTPGDPFIKQSNEAIAQHVLKQVHDLFPSSRELNMTWYSVVKLA
QSLYREGPGMDPYRPDQKTPIGNFFLAGSYTMQDYIDSMEGATISGRQAAKAILGHAAQR
SSVSQPSVVG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcgcgattgttggggcgggtctagccgggatggccacagccgttgacctagtg
gatgcaggtcacgaggttgaaattttcgaatctcgcccctttgtgggaggcaaagttgga
agctgggttgacgcagacggcaatcacatcgagatgggtctgcatgtcttctttggttgc
tattacaacctctttgagctgatgaaaaaagtagatgcgttccagcatctgcgcctcaag
gagcacacccacacctttatcaatcgcggcggcgatgtgggcgccctcgattttcgcttc
atcacgggcgcgcccttcaacggtctcaaggctttcttcaccacgtctcagctttccctg
gcagacaaggcgcaaaacgcgatcgccctcggcattagccccctggtgcgcggcctcgtc
gactttgacggcgccatgaaaacgatccgcgccctcgaccacatcagctttgcggactgg
ttccgccagcatggcggctccgatggcagcctcaagcggatgtggaacccgatcgcctac
gccttgggcttcatcgacaccgaaaatatttctgcccgctgcatgctgacgatctttcag
ttctttgcggccaaaaccgaggcgtcgatcctgcggatgctggagggctcacccgaggag
tacctgcaccggcccatcgtgaactacctggaggagcgcggcggcaagatccacctgcga
cgcggggtgcgtcagatcctgtttgagggcgaaggggaccaaacccaggtgaccggcctg
gtggtggccaacggcgactcgacggagacgatcacggcggacgcctatgtgtgcgcctgc
gacgtgccgggaattcagcgtctggtgcccgatgcttggcggcgctggtctgagtttgac
aatattttcaagctggatacggtgccggtggccacggtgcagctgcgcttcgatggctgg
gtgacggagatgcacgacgccgctcgtcgccgccagctgcaagaggcggcaggaatcgac
aacttgctgtacaccccggatgcagacttctcttgctttgcagatctggcgctgacgagc
ccgggcgactactatcgcgagggccaaggctcgctgatgcagctagtgctgacgccgggc
gatccgtttatcaagcagagcaatgaggcgatcgcccagcacgtgctcaagcaggtccat
gatctgttcccgtcttcgcgcgagctcaacatgacctggtacagcgtcgtgaagctggct
cagtccctctaccgcgaaggccccgggatggacccctaccgtcccgaccaaaaaacgccc
attggcaatttcttcttggcgggcagctacaccatgcaggattacatcgatagcatggag
ggggcgacgatttctggccgccaggcggcgaaggcgattctgggacacgcagcccagcgc
tcttcggtcagccagccgtcggttgttggctag

DBGET integrated database retrieval system