KEGG   Geitlerinema sp. PCC 7407: GEI7407_2278Help
Entry
GEI7407_2278      CDS       T02366                                 

Definition
(GenBank) protein of unknown function DUF928
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2804057..2804842)
Genome map
AA seq 261 aa AA seqDB search
MRRRQRYFSIARAGLVSLLSLSICMAPSLSLASEIGFKAPDDVGLPGRRVGGGTRGPACL
QGRLPQLVALSPSNNVGYTSEAFPRFFWYMPTTKTKTAEFTLYSVGAQRQRKDVIYRATF
GTSGTPGIASLKLPSGTTMPALEKGQYYTWTVSVICDSEDRERDIRVSGWVRYMPPEGDL
ADQLAAASESDRLKLYAENGYWFDLVAALAKMRADNPRDEAIAEQWSDLLRSQGLSRLAN
QRIISCCDSTQARRQSAGARN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggagacaacgctacttttctattgcgagagccggtttggtctctcttcttagt
ctttcgatttgtatggctccgagtctatccctagcctcggaaattggctttaaggctccg
gatgatgtgggtcttcctgggcggcgggtcggtggtggtacccgaggtcccgcatgtttg
caaggtcgactgcctcagctagtggcgctgtcccctagcaataatgttggctataccagc
gaagcgtttccgcgatttttctggtacatgcccacgaccaaaaccaaaacggcggagttt
accctttattcggtcggtgcgcagcgtcagcgcaaggatgtcatttatcgggcgactttc
ggaacctctggaacgccgggaattgctagcttaaagctccccagtgggacaacgatgccc
gctcttgaaaaggggcagtactacacttggacggtgtcggtgatctgtgattcggaggat
cgcgaacgcgatattcgggtgtctggctgggtgcgctacatgccgcctgagggtgatcta
gcagatcagctggcggcggcgtcagagagcgatcgcctaaagctctacgccgaaaatggc
tactggttcgatctcgtggcggctttggccaagatgcgcgcggataatcctcgcgatgag
gcgatcgccgagcagtggtcagaccttctgcgatcccaaggactcagccggcttgcgaat
cagcggattatttcctgctgtgatagcactcaggctcggcgccagagcgccggcgctcgg
aactag

DBGET integrated database retrieval system