KEGG   Geitlerinema sp. PCC 7407: GEI7407_2279Help
Entry
GEI7407_2279      CDS       T02366                                 

Definition
(GenBank) heat-inducible transcription repressor HrcA
  KO
K03705  
heat-inducible transcriptional repressor
Organism
gei  Geitlerinema sp. PCC 7407
Brite
Transcription factors [BR:gei03000]
 Prokaryotic Type
  Other transcription factors
   Others
    GEI7407_2279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2805097..2806197)
Genome map
AA seq 366 aa AA seqDB search
MPASKDKSGSLNLTSRQQQVLWATVRHYISTAEPVGSKALVEEYDFSVSSATIRNAMGVL
ERAGLLYQPHTSAGRIPSDSGYRIYVDKLIQPSGGFALQVEQLLSQNLRREDWGFDHLLQ
RAAQILATLSGCIALITVPQTCLVYLRHLQLVSLNHRQVMLIIVTDAYATQSVVLDLPKA
SEEEAYDLDQLERDLQILSNFLNSKLRGRSLNELAAVDWSGLDREFGSYTDFLRLLLVEL
NRRTRPLPTQILISGISEVLRQPEFSELQQVQTILHLLEEEQEQLWPLMFEPTPLEDAFG
KRVTVRIGSENPLEPMQSCTLISSVYRRGETTVGSVGVLGPTRMAYENAIAVVEAASDYL
SDTLNS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgccagcgtccaaagataaatccgggtcactcaatctcacgagtcgacagcagcaagtg
ttgtgggcgacggtccgccactacatctcgacggcagaaccggtcggctccaaagcgctg
gtggaagagtatgacttcagcgtgagctcggccaccatccggaacgccatgggggttctg
gagcgggccgggttgctgtatcagccccacacctcggcggggcgtatcccctccgattcg
gggtatcggatttatgttgacaagctaatccagccgtcgggtggctttgcgctccaggtt
gagcagcttctcagccaaaacctgcggcgcgaagactggggctttgaccatttgcttcag
cgggccgcccagatcttggcgacgctcagcggatgcattgcgctgatcacggtgccccaa
acctgcttggtgtacctgcgtcatctacagctggtgtcgctcaatcaccgccaggtgatg
ctgatcatcgtgaccgatgcctatgcgacgcagtcggtggtgctggatttgccgaaggca
agcgaggaagaggcgtacgacctcgatcagctggagcgagatttgcagattctgtcgaat
ttcctcaatagcaagctgcgggggcgatcgctcaatgaactggcggcggtggactggagt
ggcctcgatcgcgaatttgggtcctacaccgactttctgcgactgctcctcgttgagcta
aatcggcggacccggcctctgccaacccagattttgatcagcggcatttctgaggtgctc
cgccagcctgagttctcggagctgcagcaggtccagacgattttgcacctgctggaagag
gaacaagagcagctgtggccgctgatgtttgagccgacaccgctggaagatgcctttggc
aagcgggtcaccgtgcgcatcggttccgaaaatcccttggagccgatgcagtcctgcaca
ctgatctcttcggtctaccgtcgcggcgagacgacggtgggcagtgtaggagtgctgggg
ccgacgcggatggcctacgaaaatgcgatcgctgtggttgaggctgcttcggattacctc
tcagacactttaaattcataa

DBGET integrated database retrieval system