KEGG   Geitlerinema sp. PCC 7407: GEI7407_2282Help
Entry
GEI7407_2282      CDS       T02366                                 

Definition
(GenBank) peptidase M16 domain protein
  KO
K07263  
zinc protease [EC:3.4.24.-]
Organism
gei  Geitlerinema sp. PCC 7407
Brite
Enzymes [BR:gei01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     GEI7407_2282
Peptidases [BR:gei01002]
 Metallo Peptidases
  Family M16: pitrilysin family
   GEI7407_2282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2808026..2809564)
Genome map
AA seq 512 aa AA seqDB search
MNSLQIRIQAFLTAMNHVFSARQRRWLRRLGLSTLVALLLLVTASRSPAAAQTAKHYTEL
TFPALPDIQVPDYSQFQLRNGLTVYLMEDHELPLVSGEAYVRTGSRWEPANKVGLADLTA
EVMRTSGTRSHSADELNQLLEQRSAFVETAIGEDFGTASFNTLSEDLDLVFGLFAEVLQE
PVFAQEKLDLAKTQRRGGIARRNDDPDGIANREFQKLIYGRENPYARTVEYATLENIALT
DLEQFYRQSFQPQNLILGISGDFDSREMRSLVEAKFGKWRSPSRAKLPPPPQINQAETGG
VFFVNQPQLTQSYIYLGHLGGQFNDPDYPALSVMNSVLNGFGGRLFNEVRSRQGLAYSVF
GFWSPRHNHPGIFIAGGQTRSEATVPFIRSVQSEIDRIRTAPVSDVELAYAKDSVLNSFV
FNFESPEEILSRIMRYAYFDYPEDFIFRYKQQVEATTVEDVQRVAEKYLKPDQLVTLVVG
KREDIQPTLESLDVPVETLDVTIPGAPTPSAS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaactctttgcagattcgaattcaggcgtttttgaccgctatgaaccatgtgttttcg
gctcgccagcgccgctggctgcgccgtctggggctgagtaccttggtggctttgctgctg
ctggtgaccgcttcgcgatcgcccgccgctgcccagaccgccaaacactataccgagctg
acctttccggcactgcctgatattcaagtccctgactacagccagttccagctgcgcaac
ggcttgacggtctacctgatggaagaccacgagttgcccctggtgtctggagaggcctat
gtgcgcaccggcagccgctgggaaccggcaaacaaagtcggtctggcggatctgacggcg
gaggtgatgcgcaccagcggcacccgcagccacagtgccgatgagctcaaccagctcctc
gagcagcgatcggcctttgtcgaaaccgccattggcgaagactttggcacagccagcttc
aacacgctgagcgaagacctcgatctggtgtttgggctgtttgctgaggtgctccaggag
ccggtctttgctcaggaaaaactggatctagcgaagactcagcggcgcggcggcattgcg
cggcgcaacgatgacccagatggcattgccaatcgcgagttccaaaagctgatctacggt
cgcgagaatccctatgcgcggacggtggagtatgcaactctcgaaaacattgctctgacg
gatttggagcagttttatcggcagtcttttcagcctcagaacctgattttgggaatttct
ggggactttgatagtcgagaaatgcgatcgctggtggaagccaagtttggcaaatggcga
tcgccgtctcgcgcaaagctgccgccgccgccccagattaaccaggcggagactggcgga
gtgttctttgtcaaccagccccagctcacccagagctacatctacctgggacacttgggc
ggtcagttcaacgacccagactatccggccctcagcgtgatgaacagcgtgctcaatggc
tttggcgggcgcttgttcaatgaggtgcgatcgcgccagggcttggcctacagcgtgttt
gggttctggagcccgcgccacaaccaccccggcattttcattgcggggggccagacgcgc
tcagaggctacggtgcctttcattcggtcggtgcagtcggaaatcgatcgcattcgcact
gcgccggtctcggatgtcgagctggcctacgccaaggactccgtgctcaactcctttgtg
ttcaacttcgagagcccggaggaaatcctcagccggatcatgcgctacgcctactttgac
tacccggaggactttattttccggtacaagcagcaggtcgaggcgacgacggttgaggac
gtgcagcgagtggctgagaagtacctgaagcccgatcagctggtgaccctggtggtgggc
aagcgggaggacattcagcccacgctggagagcctagatgtgccggtggagactctggat
gtgacaatcccgggagcgccgacgccttcggcctcctag

DBGET integrated database retrieval system