KEGG   Geitlerinema sp. PCC 7407: GEI7407_2288Help
Entry
GEI7407_2288      CDS       T02366                                 

Definition
(GenBank) acyl-phosphate glycerol-3-phosphate acyltransferase
  KO
K08591  
glycerol-3-phosphate acyltransferase PlsY [EC:2.3.1.15]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    GEI7407_2288
   00564 Glycerophospholipid metabolism
    GEI7407_2288
Enzymes [BR:gei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     GEI7407_2288
Lipid biosynthesis proteins [BR:gei01004]
 Phospholipid acyltransferase
  GPAT
   GEI7407_2288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2814885..2815556
Genome map
AA seq 223 aa AA seqDB search
MVLWLVWSAALLLGAYLLGSIATGYWLGYALKGIDIRQHGSGSTGATNVLRTLGKGPAIA
VLLIDMLKGLLAVLLIGPGLVWASERFLPAGVVDFALWSDWLRALAGLAALIGHSKSPWI
GFTGGKSVASSLGVLLALHWPVALGTLGVFAAVLSLSQIVSLSSIVGAIAVTVFMIAFRQ
PVPYLLFAIAGGVYVIVRHRTNIQRLVAGTEPRIGQKSSQGPT
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtgctttggctggtgtggagcgcagcgctgctgctgggggcgtacctgctgggttcg
atcgcgacgggttattggctggggtacgcgctaaagggcattgatattcgccagcatggc
tcgggatcgaccggagcaaccaacgtgctgcggaccctcggcaagggtccagcgatcgcc
gttttgctgatcgacatgctgaagggtctgctggccgtgctgctgatcggccctggcctg
gtgtgggcttcggagcgctttttgccagcgggcgtggttgactttgccttgtggagcgac
tggctgcgcgccctggccggactggcagccctgatcggccacagcaagtccccatggatc
ggcttcaccggcggcaaatccgtggcgtccagcctgggggttttgctggcgctgcattgg
ccggttgccctgggcacgctgggcgttttcgcggcggttttgtccctctcccagattgtt
tccctcagctccattgtgggggcgatcgccgtaaccgtgtttatgattgcgtttcggcag
cctgtgccctatctgctatttgcgatcgcgggcggggtctacgtgatcgtgcgtcaccgg
accaacatccagcgcctagtggcaggcaccgaaccccgcatcggccaaaaatcctcccaa
ggcccgacttag

DBGET integrated database retrieval system