KEGG   Geitlerinema sp. PCC 7407: GEI7407_2291Help
Entry
GEI7407_2291      CDS       T02366                                 

Definition
(GenBank) phenylalanyl-tRNA synthetase beta subunit
  KO
K01890  
phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:gei00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    GEI7407_2291
Enzymes [BR:gei01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     GEI7407_2291
Amino acid related enzymes [BR:gei01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   GEI7407_2291
Transfer RNA biogenesis [BR:gei03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    GEI7407_2291
 Prokaryotic Type
    GEI7407_2291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2817596..2820046)
Genome map
AA seq 816 aa AA seqDB search
MRISLNWLQELVDISLSPEALAETLTMAGFEVEDIEDRRTWADGVVVGKVLSREQHPNAD
KLSVCQVDVGAESGPLNIVCGAANVRADIYVAVATVGTYLPAIDLKLRPTKLRGVRSEGM
ICSLSEVGLEKDSEGIHIFGEAGLQPGADVRPLLGLEDVVLDLTSTANRADALSMVGVAR
EVAALTGATLRLPGADLEAIAQPEDASKLAVQVQEPKACPAYIGTMIENVNIQPSPEWLK
RRLQAAGVRPINNVVDVTNYVLLEWGQPLHAFDRDRLQQVAGAGALTLGVRFGRSDESLT
TLDSQKRKLQNQSLVITANDRPVALAGVMGGEDTEVHGGTTNLVLEAALFDSVAIRRSAR
SQGLRTEASTRYERGVNQAELEVAARRALALLLDLAGGTVVAQAIADSRPSQATWTRSIE
LRLERVNQVLGLVEVEDADPRELQPQEVERSLTALGCQVQPTDRKDVWSVTVPPYRYRDL
EREIDLIEEVARLYGYDKFCETLPDKSEAGYLSLEQELTRSLRAAFRGVGLTELMHYSLV
KPVHESQVTLANPLFAEYSALRTELIEGLVDAFQYNLEQGNGPLNAFEIGRVFWQDDLGF
HEMDALAGVMGGDASVGRWRRSGREQPMNWYEAKGLLESAFQRLGIKVEYQPDRRDSRLH
PGRTASLWIRGERLGTFGQLHPQLRRDRDLPDDVYIFTLSLDLLLGELSRDEALTPLFKP
FSSYPATDRDIAFFAPLAVSVVDLEKAIARAGGDLLESAELFDEYQGEGVPAGQRSLAFR
LVYRASDRTLTEADVEPVHQRVRELLSEKFSVSLRS
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatttccctaaactggctacaagaactcgtagacatctctctctccccggaggcg
ttggccgaaacgctgacgatggcgggctttgaggtggaggatattgaagaccggcgcacc
tgggctgatggcgttgtggttggtaaggtgctgagccgagagcagcaccccaacgcggac
aagctcagcgtttgccaggtcgatgtcggggcggagagcggcccgctaaatattgtgtgc
ggggctgccaatgtccgagcggacatctatgtagcggtggcgacggtgggcacctatctg
ccggcgatcgacctgaagctgcggccgaccaagctgcggggagtgcgctcagagggaatg
atttgttcgctgtctgaggtgggtctagaaaaagactcggagggcattcacatctttggt
gaggcgggactgcagccgggagccgatgtgcggccgctgctgggcctcgaggatgtggtg
ctggacttgacgtcgacggccaaccgagcggacgccttgagcatggtcggggtggctcga
gaggtggctgcgctgacgggagcgacgctgcggctgccgggggcagacttggaggcgatc
gctcagcccgaggacgcgtcgaaattggcggtgcaggtccaggagccgaaggcctgtccg
gcctacatcggcacgatgattgaaaatgtcaacattcagccgtcccctgagtggctcaag
cggcgccttcaggcggcgggggtgcgccctattaataatgtggtggatgtcaccaactat
gtgctactggagtgggggcagccgctgcacgccttcgatcgcgatcgcctccagcaggta
gccggagccggtgctttgaccctgggcgtccggtttggccgttccgatgaaagcctcacg
accctggacagccaaaagcgcaagctgcaaaaccagtctctggtcatcacggcaaacgat
cgccctgttgcgctggcgggggtgatgggcggcgaagacaccgaggtgcacgggggcacg
accaacctcgtccttgaggcggccttgtttgactctgtggcgatccggcgatcggctcgg
agccagggtctgcgcactgaggcttcgacccgctacgagcgaggcgtcaaccaggcagaa
ctggaggtggcggctcgtcgcgccttggccctcctgctggatctggcgggcgggaccgtg
gttgcccaggcgatcgccgatagtcgtcccagccaggccacctggacccgctccatcgag
ctgcgcctagagcgcgtcaaccaggtgctgggtcttgtggaggtggaggacgccgacccg
cgcgagctgcagccccaggaagtcgagcgcagcctgaccgccctgggctgccaagtccag
ccgacggatcgcaaggacgtgtggagcgtgacggtgcctccctaccggtaccgcgatctc
gagcgagaaatcgacctgatcgaagaagtggcgcgcctctacggctatgacaagttttgc
gagaccctgccggacaagagcgaagcgggctatctgtccctcgagcaggaactgacgcga
tcgctgcgcgcggcgtttcgcggggttggcctgacggagctgatgcactactccctggtt
aaaccggttcacgaatcccaagttacccttgccaatcccctcttcgccgaatactcagcc
ctgcggacagagctgatcgagggcctggttgacgccttccagtacaacttggagcagggc
aacgggccgctcaacgcctttgagattggccgtgtgttctggcaggacgacctgggattc
catgaaatggatgctctggcgggggtgatgggcggtgatgcctcggtgggccgatggcgg
cgctctggtcgcgaacagcccatgaactggtacgaggccaagggcctgctggagagcgcc
ttccagcgcctgggcatcaaggtggaatatcagcccgatcgccgggatagtcgcctgcac
ccgggccgaaccgcctccctctggattcgcggagagcgcctgggcacctttggccagctg
catccccagctgcggcgcgatcgcgatttgccggacgacgtctatattttcaccctgtct
ctggacttgctcttgggtgagctgagccgcgatgaggcgctaacgcccttgtttaagccc
ttttcgtcctatcctgcgacggatcgcgacattgctttcttcgcgccgctggcggtgtcc
gtagtggacctggaaaaggcgatcgcccgcgccgggggagacctgctggagtctgctgag
ctgtttgacgagtaccagggagaaggcgtccccgcagggcagcggagcctggcattccgg
ctggtgtaccgggcgagcgatcgcaccctgaccgaggccgacgtggagccagtgcaccag
cgcgtccgggagctgctgagcgaaaagttcagcgtgagcctgcgcagctag

DBGET integrated database retrieval system