KEGG   Geitlerinema sp. PCC 7407: GEI7407_2297Help
Entry
GEI7407_2297      CDS       T02366                                 

Definition
(GenBank) ATP synthase F1 subcomplex beta subunit
  KO
K02112  
F-type H+-transporting ATPase subunit beta [EC:3.6.3.14]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Oxidative phosphorylation
Photosynthesis
Metabolic pathways
Module
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    GEI7407_2297
   00195 Photosynthesis
    GEI7407_2297
Enzymes [BR:gei01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     GEI7407_2297
Photosynthesis proteins [BR:gei00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   GEI7407_2297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2826825..2828282
Genome map
AA seq 485 aa AA seqDB search
MVTTTEKTNVGRITQVIGPVVDVEFPTGKMPQIYNALRVQGKNEAGEDVTVTCEVQQLLG
DNQIRAVSMSSTDGLIRGMEVVDTGAPISVPVGVATLGRIFNVLGEPVDNQGPVNTQETF
PIHRPAPKLTELETKPSVFETGIKVIDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIA
TNHGGVSVFGGVGERTREGNDLYNEMIESGVIDKNDLSKSKIALVYGQMNEPPGARMRVG
LSALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGDLQ
ERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRNLAAKGIYPAVDPLDS
TSTMLQPAIVGDEHYGTARAVQATLQRYKELQDIIAILGLDELSEDDRVTVARARKIERF
LSQPFFVAEVFTGAPGKYVKLEDTIKGFQMILKGELDDLPEQAFYLVGDINEAIAKAEKI
KAENK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccaccacagaaaagacaaacgttggtcgcattacgcaggtcattggccctgtc
gtagacgttgaattccccaccggcaagatgccgcagatctacaacgctctccgcgttcaa
ggcaagaacgaagctggcgaagatgtcaccgttacttgcgaagtgcagcagctgctgggc
gacaaccaaatccgcgccgtatccatgagctccacggacggcctgatccgtggcatggag
gtggtagacaccggtgctcccatcagcgtgccggttggcgttgccaccctcggacggatc
ttcaacgttctgggcgagcccgttgacaaccaagggcctgtcaacacccaagaaaccttc
cccatccaccgtccggctcccaagctcacggaacttgaaaccaagccttccgtgtttgag
acggggatcaaggtgatcgacctgctgaccccctatcgtcgtggtggcaaaattggtctg
ttcggcggtgcaggtgtcggcaagaccgtcatcatgatggaactcatcaacaacatcgcg
accaatcacggtggtgtatccgtgttcggcggcgtgggtgagcggactcgtgaagggaac
gacctttacaacgagatgatcgagtccggcgtaatcgacaagaacgacctcagcaagtcc
aagattgccttggtctacggtcagatgaacgagccccccggagctcggatgcgcgtcggc
ctgtcggctctgacgatggctgaatacttccgggatgtgaacaagcaggacgtgctgctg
ttcatcgacaacatcttccgcttcgttcaagcgggttctgaggtgtctgcactgctgggc
cggatgccctctgctgtgggctaccagccgaccctcggtaccgacgtgggcgacctgcaa
gagcggatcacctccaccaccgaaggctccatcacctccattcaggcggtgtacgtgccg
gcggatgacttgaccgaccccgctcctgcaaccacctttgcgcaccttgacggtacgacg
gtgctgtcccggaacctggccgccaagggtatttaccccgctgtggatcccctggattcc
acctcgacgatgctgcaacccgcgatcgtgggtgatgagcactacggcaccgcccgggca
gtgcaggcgaccctccagcgctacaaagagctgcaggacatcatcgcgattctgggtctt
gacgagctttctgaagatgaccgtgtgacggtggctcgggctcggaagatcgagcgtttc
ctgtctcagcccttctttgtggcagaggtcttcacgggcgctcctggtaagtatgtgaag
ctggaggacaccatcaagggcttccagatgatcctcaagggcgaactagacgatctgcct
gagcaggcattctacctggttggcgacatcaacgaggcgatcgccaaggccgagaagatc
aaggccgaaaacaagtaa

DBGET integrated database retrieval system