KEGG   Geitlerinema sp. PCC 7407: GEI7407_2300Help
Entry
GEI7407_2300      CDS       T02366                                 

Definition
(GenBank) HAD superfamily (subfamily IA) hydrolase, TIGR01548
  KO
K11777  
HAD superfamily phosphatase
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2829528..2830307
Genome map
AA seq 259 aa AA seqDB search
MSAIVVFDIDGVVRDVSGSYRRALADTVEHFTAGGYRPSPEDIDALKGEGIWNNDWHASQ
ELVYRYFEGQGQTRSQLNLDYEGLVAFFQERYRGTDPVNWNGYICQEPLLMSKAYLESLS
AAGITWGFFSGATKASATYVLERRIGLNQPVLVAMEDAPGKPDPTGLFAAIAALETPETT
GQSVLYVGDTVADMYTITKARAQAPERPWKAVGVLPPHVQADEQRALAYADTLRQAGADV
CLGSVENLTPAVIRDLIGA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgcgattgttgtttttgatattgatggcgttgttcgagatgtgagcggctcctac
cgccgggcgctggcggatacggtggagcactttacggcgggcggctaccggccctctcca
gaggacattgacgccctcaagggcgagggaatctggaataacgactggcacgcgtcccaa
gagttggtgtatcgctattttgagggccagggccagacgcgatcgcagcttaatttggac
tacgaagggctggtggctttcttccaagagcgctatcggggcaccgacccggtgaactgg
aatggctatatctgccaggagcctttgctcatgagcaaggcttatctcgaaagcttgagc
gctgcgggcatcacctggggattttttagcggggcgacgaaggcttcggcaacctatgtg
ctggagcggcggatagggctcaaccagccggttttggtggcgatggaggacgcgccggga
aaaccggatccgacgggcctgtttgccgcgatcgccgccctggaaacgccagagactact
ggccagagcgtgctctacgtcggcgatacggtggccgacatgtacaccatcaccaaggcg
cgcgcccaggccccagagcgcccgtggaaggccgttggggtgctgccgccccacgtccag
gcggacgagcagcgggccctagcctatgccgatacgctgcggcaggcgggcgcggacgtg
tgtctggggtcggttgagaacctcacgcccgcggtgattcgggatctgatcggcgcctag

DBGET integrated database retrieval system