KEGG   Geitlerinema sp. PCC 7407: GEI7407_2302Help
Entry
GEI7407_2302      CDS       T02366                                 

Definition
(GenBank) Holliday junction DNA helicase subunit RuvB
  KO
K03551  
holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gei00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GEI7407_2302
Enzymes [BR:gei01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GEI7407_2302
DNA repair and recombination proteins [BR:gei03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     GEI7407_2302
    RecFOR pathway proteins
     GEI7407_2302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2831222..2832331)
Genome map
AA seq 369 aa AA seqDB search
MAIISSQGPAPEAQPPARRRREAAPPVPEADPSLLQPESGPEEIGKQEEGLRPQHLADYI
GQKALKDVLHIAIQAAQSRQEPLDHLLLYGPPGLGKTTLALILASEMGVSCKITTAPALE
RPRDIVGLLINLQPGDVLFIDEIHRLPRVTEEILYPAMEDCRIDITIGKGQSARTRSLPL
PHFTLVGATTRVGALTSPLRDRFGLVQRLRFYELDELSAIVMRTAQILATPITAAGAEEI
ARRARGTPRIANRLLKRVRDYAAVKALGEVDAAIAAEALELFNVDPCGLDWTDRRLLSAI
VENFGGGPVGLETLAAATGEDAQTIEEVYEPYLLQIGYLQRTPRGRTATAAAWRHLGYDP
PNHQLSVFR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggccattatttcctcccaagggcccgcgcccgaagcccaacccccggcccgtcgtcgc
cgagaggctgcgcctcctgtccctgaggccgacccgtctttgctccagccagagtctggc
ccggaggagatcggcaagcaagaagaagggctgcgtccccagcacctagcagactacatc
ggccaaaaggccctcaaagatgtcctgcacattgccatccaggctgcccagtcgcgccaa
gagcccctcgaccacctgctgctctacggtccaccgggtctggggaaaacgaccctggcg
ctgattttggcctctgagatgggcgtgagctgcaagatcaccaccgcgcctgccctagag
cggccccgcgacattgttggcctgctgatcaacctgcagccgggagacgtgctgtttatc
gatgagattcaccgactgccgcgggtgaccgaggagattctctatccggccatggaggac
tgccggatcgatatcaccatcggcaaaggccaaagcgcccggacccgcagcctgccgctg
ccgcactttaccctggtgggggctaccacgcgggtgggcgctttgacgtcgcctctgcgc
gatcgctttggcctggtgcagcggctgcgcttctatgagctcgatgagctgagcgccatt
gtgatgcggacggctcagattctggcgacgcccatcacggctgcgggcgccgaagaaatc
gctcggcgggctcgggggacgccgcgcattgccaaccgcttgctcaagcgagtgcgggac
tatgccgccgtcaaggccctcggcgaagtcgacgcggcgatcgccgctgaagcgctggag
ctctttaacgttgacccctgcgggctcgactggaccgatcgccgcctcctgagcgccatc
gtcgagaactttgggggcgggccggtgggcctggaaactctggcggcggccaccggcgaa
gacgcccagaccatcgaagaggtctatgagccctacctcctgcaaatcggctaccttcag
cggacgcctcggggccggacggccaccgctgcggcctggcgacatctgggctacgatccg
ccgaatcatcagctttcggtttttcggtaa

DBGET integrated database retrieval system