KEGG   Geitlerinema sp. PCC 7407: GEI7407_2304Help
Entry
GEI7407_2304      CDS       T02366                                 

Definition
(GenBank) ABC-2 type transporter
  KO
K09690  
lipopolysaccharide transport system permease protein
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
ABC transporters
Module
Lipopolysaccharide transport system
Brite
KEGG Orthology (KO) [BR:gei00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    GEI7407_2304
Transporters [BR:gei02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter [MD:M00250] [OT]
    GEI7407_2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2833152..2834066
Genome map
AA seq 304 aa AA seqDB search
MKGAVQKASGATRWASSAAPLWVLKRGLRLFLWATRWIPVKAEWRTKASLLKALVQRDLE
ARYKGSTLGNLWPLLNQLSQLLIYTYVFSVVLRVKLSLQGLPPNNLTFGLWLFAGLLPWI
AFTSGFTQASTSVIGQPNLIKKVVFPLELLPLVPVLSAFIESTFGLMALITLVAIASDTL
HPTLCLLPLVWLPQLLLTTGLGYLTSSLTVFLRDIPQTIGVLLNLWFYMTPIVYPSSVIP
EAFREWIFLLNPLAAIAELYRDLILVGQVEHWKEWLMTYLISGVVFGVGYWCYRKLRPAF
ADVL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggagccgtccaaaaagccagcggtgcgacccgctgggcctcatctgctgctcct
ctgtgggtgctcaagcgcggtctgcgcctttttttgtgggcaacccgctggattccggtc
aaagctgagtggcgcaccaaagcgagtttgctcaaggctctggtccagcgggacctagaa
gcgcgctacaagggctcgaccctcgggaatctttggcctttgctcaatcaactgtcccag
ctgctgatctacacctacgttttctcggtggtgctgcgggtcaagctgagtctccagggc
ctcccgcccaacaatctcacctttgggctgtggctttttgcggggctgctgccctggatt
gcctttaccagcggctttacccaggcttctacgtcggtgattggtcagcccaatttgatt
aaaaaggtcgtctttcctctagagctattgcctctggtgccggtgctctcagcctttatc
gagagcacttttggtctgatggctctgatcacgctggtggcgatcgcctctgacacgctc
cacccgacgctctgcctgctgccgctggtgtggctgccccagctcctgctgacgacaggc
ctgggctacctgacctccagcctgacggtctttttgcgcgacattccccaaaccatcggc
gtcctgctgaatttgtggttctacatgacgccgatcgtatatccctcgtcggtcatccca
gaggcgttccgcgagtggatctttttgctgaacccgctagcggcgatcgccgagctctac
cgagacctgatcttggtcggccaggtcgagcactggaaagaatggctgatgacctacctc
atctcgggcgtggtctttggggttggatactggtgctatcgcaagctccgcccagccttc
gccgatgtgctctag

DBGET integrated database retrieval system