KEGG   Geitlerinema sp. PCC 7407: GEI7407_2308Help
Entry
GEI7407_2308      CDS       T02366                                 

Definition
(GenBank) UDP-N-acetylglucosamine 2-epimerase
  KO
K13019  
UDP-GlcNAc3NAcA epimerase [EC:5.1.3.23]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GEI7407_2308
Enzymes [BR:gei01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.23  UDP-2,3-diacetamido-2,3-dideoxyglucuronic acid 2-epimerase
     GEI7407_2308
Lipopolysaccharide biosynthesis proteins [BR:gei01005]
 Unusual sugar
  GEI7407_2308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2837344..2838450)
Genome map
AA seq 368 aa AA seqDB search
MKLVTVVGARPQFIKAATVSRAIANHNQSNLAPQVHEVIVHTGQHHDASMSDVFFEQMAI
PTPDHHLGVSGGGHGQMTGRMLQGIEEVLIEEKPDAVLVYGDTNSTLAGALAAAKLHIPV
AHVEAGLRSFNMRMPEEINRILTDRISRWLFCPTETAVQNLQNEGFESFEGTWLENVGDV
MYDAAIFYQDLAEGTPLTQQILEENQGNFYLATVHRAENTNSLARLRSIFKALEQISAST
SIVIPLHPRTRKILNEFNISISQINTIDPVGYFEMLHLLKHCLGVITDSGGLQKEAYFFR
KPCLTLRDETEWLELVKCGANFLVGADEQKILSSESHLKLANSSIFANKLYGAGKSAEKI
IDILTQAF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagtgacagtagttggtgctagaccgcagtttatcaaggcggcgacagtttca
agagcgatcgcaaatcataaccagagcaaccttgcacctcaggttcatgaggttattgtc
catacagggcagcatcatgacgccagtatgtctgacgtctttttcgagcaaatggcaatt
ccaacaccagatcatcatcttggtgtttctggcggaggccacggtcagatgactggccgt
atgcttcaaggaatcgaagaagtactgattgaagagaaaccagacgctgtattggtttat
ggtgacacaaattcaactttggccggtgctttagctgcggccaagcttcatatccctgta
gcccatgtggaagcgggcttgcggtcttttaatatgcgaatgccagaagagataaaccgt
atattaactgatcgaatttcacgctggctcttttgcccaacagaaacagcagtgcaaaat
cttcaaaatgagggatttgaaagttttgaaggaacttggctagaaaatgttggcgatgta
atgtatgatgctgctattttctatcaagacctagctgaaggcacgcctctaactcagcag
atcttagaggaaaatcaaggaaatttctacttagcaacagttcatcgagctgaaaatact
aatagcctagcaagactaagatcgatttttaaggcattggagcaaatttccgcttctaca
tcaattgttattcctcttcacccaagaactagaaaaattctaaatgaattcaatatatcc
atctctcaaattaatactattgatcccgtaggttactttgagatgcttcatttgctgaag
cactgtttgggagtcataactgatagtggaggcttgcaaaaggaagcttacttcttccga
aaaccctgccttaccctgcgagatgaaactgagtggctggagttagtgaaatgcggagct
aatttcctagtaggtgctgatgagcaaaaaatactctcgtcggaaagccatcttaaatta
gcaaattcaagcatttttgctaacaaactttatggagctggaaaatctgctgaaaaaata
attgatattttgactcaggcgttttag

DBGET integrated database retrieval system