KEGG   Geitlerinema sp. PCC 7407: GEI7407_2310Help
Entry
GEI7407_2310      CDS       T02366                                 

Definition
(GenBank) hypothetical protein
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2839588..2840964)
Genome map
AA seq 458 aa AA seqDB search
MKSLEAVKIKPIKVNSKNFFLIFLTLTYLGLVIWSYLTLISPRYTYLGYIANPRSPFIHC
TSFLLALIPSLGLTKKVDRPSQVLIWFIYLLVLLPSLTVPFYATSLSSFKLIVYSCVTIA
GFWILSFFSQIPHFQEPRLRVSKTVFYFVASILVVVFLCLLVKTFGFSLKWINFLDVYDV
RANYKSSLKSAFGMVPYLVIWQGNVINPFLMVYGLSQRKWIWLLVGLVLQLFIYSVTGLK
SVSLSFLLVLCIFWGIGAKYKSNNFGTYLLTGASSLILICVFLAKFFNFHLPLSFLVRRL
IITPGLLTGFYWDFFATHPKAFLGHSLLKDLVEYPYSKSPPFIIGEMYFDNASTSANANF
WADSFANFGLSGILMFSVLLGIFIWLFDSVSKPIDLRVSSTMLSVTGFSLINSALLTSLV
THGLILTLMVMACLPTRKLQLSTCSALVQKNDSNLMSD
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtctagaagcagtaaaaattaagccaataaaagttaattcaaaaaattttttt
ttaatatttttgaccttaacctatcttggactcgtaatttggtcttatctaactttaata
tctccccgatacacctatttaggctacattgcaaatcctagatctcctttcatacactgc
accagctttttactagctttgattccgtctttgggtttaaccaagaaggtggatagacct
tctcaggtactcatatggtttatatacttattagttcttctgcctagcttgacggtgcca
ttttatgctactagcctgtcttcctttaagttaatagtttactcttgtgtaacaatagct
ggtttctggatactaagcttcttctcacaaattccacatttccaggaacctagactcaga
gtgtcaaagactgtattttactttgtcgcttccattttggttgtagtctttctatgtcta
ttggttaaaacgtttgggttctctctaaagtggattaatttcttggatgtttatgacgtt
cgagcgaactataagagttccttgaaatctgcttttgggatggttccatatcttgtaatc
tggcaaggaaacgttattaatccattcttgatggtttacggtttgtctcagcgaaagtgg
atatggcttctagttggcttagtgctgcaactctttatttactcagttactggccttaaa
agcgtctctctttcttttttgcttgttttgtgtattttttggggaattggagcaaaatat
aaatctaataattttggaacttatctattaaccggtgcttccagcttgattttgatatgt
gtgttcttggctaagtttttcaactttcatctcccactgtcttttctcgtaaggagatta
ataattacacctggattattaacagggttctattgggatttctttgcgactcatccaaaa
gcctttttaggccatagcttattgaaagacttggtggagtacccatacagcaagtctcca
ccttttataataggagagatgtattttgataatgcttctacatcggcaaatgctaatttt
tgggcagattcttttgctaactttggcctttccggaatcctaatgttttcggttttgctg
ggaatttttatctggttatttgatagtgtttccaagccaatagatctgagggtgtcaagt
actatgctgagcgttacaggttttagtttgattaattctgctctcttgacaagcttggtg
acccacggacttattttaactcttatggtcatggcttgtcttcccaccagaaagcttcag
ctatctacttgtagtgcgcttgtgcagaaaaatgactcaaatttgatgagcgactaa

DBGET integrated database retrieval system