KEGG   Geitlerinema sp. PCC 7407: GEI7407_2317Help
Entry
GEI7407_2317      CDS       T02366                                 

Definition
(GenBank) lipopolysaccharide biosynthesis protein
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2848112..2849002
Genome map
AA seq 296 aa AA seqDB search
MSRDSSYQSSSDDEISLADIIRFFLRNLTLIGLITIGFTGLALVYSLTRPANYQQKSVLA
IQANPIKLADRTFPAENTANLNNLVISALNNQDNLSIQASSTFDAGTQQLTVTATGTKAE
ALKSFSTSLPTFIQDTLQSHLNKQVLATITAADIEQSRANEALAQLNQQINTIGPSLNNS
SIAAIARLNALEEQRAILTTNLALRQADSRYLDEAKASPQAFIDKVVSISVLAQSEVEKL
GFQKRSIVLIAITSFIMAVLVAIVREQLVLIGNADAQKTLAAPQSELEDLEESRQP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcgagattctagttatcaatcgtcatccgatgacgaaatttccttggccgacatt
attcgcttttttctgcgaaacttgacactaattggcttaattacgattggatttacggga
ctggctttagtttattctctgactcgtcctgcaaactatcagcagaagagcgtgctcgcg
attcaggcaaatcccatcaagcttgccgatcgtacttttcctgcagaaaatactgccaat
ttaaacaatttagtcatttcagctttaaacaatcaagataatctatcaattcaagcaagc
agcacctttgacgcggggactcagcagctgacagttacagctaccggtactaaagcagag
gcactgaagagcttttcgactagcctacctacttttattcaggacacgcttcaaagccat
ctcaacaagcaagttttagcaacgattacagcagcagatatcgagcagagccgtgcgaac
gaagcgcttgctcagctcaatcagcaaattaataccattggcccatctttaaataattct
tctattgctgcgatcgcccgtttgaatgctctggaagagcagcgcgctattctcacaaca
aacttagcgctgaggcaggcggacagccgctatctggatgaggccaaggcatcaccgcaa
gccttcatcgataaggtggtttccatcagcgtgctcgcccaaagcgaggtggagaaactc
ggcttccaaaagcgatcgatcgttctgattgccatcaccagcttcatcatggccgtttta
gttgccatcgtacgagagcagcttgttctcatcggcaatgcggatgcccagaagacacta
gcggcccctcaaagcgagttggaagatctcgaagagtcccgtcaaccctga

DBGET integrated database retrieval system