KEGG   Geitlerinema sp. PCC 7407: GEI7407_2319Help
Entry
GEI7407_2319      CDS       T02366                                 

Definition
(GenBank) O-antigen polymerase
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2850971..2853025
Genome map
AA seq 684 aa AA seqDB search
MLGVESSKSHFSLALRFQISFCFLIFGWEFLSLVLGDHASFPVLNAAFAGVSWILAFWRP
AIALGILVFVLPFTGGIIDQINALFSVEIEALRSLSFDLVAGFLGGVGCRMLLRLEQKTA
NNPEGVYSPAQRILTGGLLVFYGLVILTGAIALSRNLAQAASPFFLDGFIYNFINFRYLN
PFSDYFPLQDIALFGGAIALATYLIPRFHSHQHIHSSITLPLIASQGLLVLYALAQKVLG
IGFLRSGAERGVNSFLPDIHAYGGYMLIGCFLGLYYLEKREGKWSDRRFAFSLLGLSSLG
VLLSGSRFSIGLLFLVLLVRLLWNESFSLRQRLIYSAAGLLGAWAIAGLLSVALPNLKLL
SPGKIFQAQSFQDVNIALSYRPEIFQSSLKMFSSYPWLGIGKGEFYRQSSIGDFSESFFF
SRQHRGENAHNYFLQILTEMGIIGFASFAFIFIYKYWVYQSTSEAIWVMLLGIAAGNLYG
HSLLLPNILFLAFILIGAGNGPDVPVPPVFQRLRLPRAPKTWILSVGGLAALLGVAGVEV
AGAYERVPFRSEYACHRFAFYPDGQTGGIFEQEFRAGSRFLVAEYRVHHSHVRQHPLELS
WAIAQKGRTIQQVTQTLYRRGHYQQILDLSALRPRSKFTLTLKATPCFTPLNAGDSLDMR
RLGVQLLEIRQQPTPLVKQESGSA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgttaggagttgagagttctaaatcccatttcagtctggctctgcgctttcaaattagc
ttttgttttttgatttttgggtgggagtttctgagcttagttctaggcgaccacgctagc
tttccagtgttgaatgcagcctttgccggcgtgagctggattctggctttttggcggccc
gcgatcgccctgggaatattggtctttgtcctaccttttacgggcggcatcattgatcag
attaatgcccttttctcagttgaaattgaagctttgcgctctttaagctttgatctggtc
gctggatttctgggtggggtagggtgccgcatgctgcttcggcttgagcaaaagacagca
aacaatccagaaggcgtttactctccagcacagcggatcttaacgggaggattactggtc
ttttatggcttggtgattctgaccggagcgatcgccctttctcgaaatctcgctcaggcc
gcttcgccctttttcctcgatggcttcatttataatttcatcaattttcgttatctcaat
cccttttcagattactttccgctccaggacattgcgctttttggcggagcgatcgccctg
gcaacttatctaattcctcgctttcattctcatcaacatattcactcgagcattaccctg
ccgctgattgcgtctcaaggcctgctagttctgtatgccctcgcccaaaaggtcctggga
atcggttttttgcgcagcggagccgagcgcggagtcaacagctttttgcccgacattcac
gcctacggcggctatatgctcattggctgctttctgggtctctactatttggagaaacgt
gaaggcaaatggagcgatcgccgttttgcttttagcctgcttggtctatcgagtttgggc
gttttgctgagcggttctcggttctcgattgggcttttgtttcttgtgctgttggtcagg
cttttgtggaacgagagcttcagtctgcgccagcgcctgatctactcagccgctgggctt
ctgggggcctgggcgatcgccggtttgctgtccgtggccttgcccaatctcaagctgctg
agccccggaaaaatctttcaggcgcaatcttttcaggacgtcaatattgcccttagctat
cggcccgaaatttttcagtcgagcctcaaaatgttctcaagctacccctggcttggcatc
ggcaaaggagagttttatcgacaaagttccattggagactttagcgagtcttttttcttt
tctcgacagcatcgaggcgaaaacgctcacaattattttctgcaaatcctcactgaaatg
gggataattggctttgcatcttttgcctttatttttatttacaaatactgggtgtatcag
agcacctctgaagccatttgggtgatgctgctgggcattgcggcgggcaatctctatggc
cactcgctcctgctgcccaatattttatttttggcatttattttgattggcgcgggcaat
gggcctgacgtgccagtcccgcccgtttttcagcgcctgcggctcccgcgagctcccaag
acctggatactgagcgtgggaggactggctgcccttctaggagtcgccggagtcgaggtg
gctggggcctatgagcgggtcccttttcgctcggagtatgcttgccaccgcttcgcgttt
tacccggatgggcagaccggcggcatcttcgagcaggagtttcgggccggatcgcggttt
ttggtggcggaatatagagtgcatcactcgcacgtgaggcagcatcctctagagttatct
tgggcgatcgcccaaaaaggccgcaccatccagcaagtcacccagaccctttatcggcga
ggccactatcagcaaattctcgatttgtctgcgctgcgtcctcggtcaaaatttacgctg
acgctcaaagccaccccctgctttacgcctctaaacgcaggcgatagcctggatatgcgg
cggctgggcgtacagctgctggagattcgtcagcaaccaactccgctcgtcaagcaagaa
agtgggtccgcgtga

DBGET integrated database retrieval system