KEGG   Geitlerinema sp. PCC 7407: GEI7407_2320Help
Entry
GEI7407_2320      CDS       T02366                                 

Definition
(GenBank) ABC transporter related protein
  KO
K09691  
lipopolysaccharide transport system ATP-binding protein
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
ABC transporters
Module
Lipopolysaccharide transport system
Brite
KEGG Orthology (KO) [BR:gei00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    GEI7407_2320
Transporters [BR:gei02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter [MD:M00250] [OT]
    GEI7407_2320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2853022..2854314
Genome map
AA seq 430 aa AA seqDB search
MSNVAIALKNISKCYRLYRRPSDRLKELLIPGKLRAREFWALRNISLEVKEGETLGIVGQ
NGSGKSTLLQIIAGTLTPSEGEVTVNGRVAALLELGSGFNPEFTGRQNVFFNGQILGLAR
EEVEAKFDAIAAFADIGEFIDQPVKTYSSGMAVRLAFAVVAHTEPRILIVDEALAVGDAK
FQVRCMQRIRQMKDQGVTILFVSHDASSVKMLCDQAILLHHGEAIRSGQPREVVNYYIEL
LNSGSTQPAADVSETATSPEELASIRRTTAAQGADDVELKARRYGTKLAVFQEIKITDAH
GQEAEKLETGSTFHISISLEAMAELSDLVVGISIRNLMGVVMYGTNTYHLDSKLPSLEAG
QTITLTFQLPCQLNRGVYTVTVGAHSEGGLSYDWVDELVVFEVYNTSQCEGFVDLASEVR
YEVLSSALPS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaatgtagccattgccctcaaaaatatttccaagtgctaccggctttatcgccgt
ccctccgatcgcctcaaagaattgctcattccgggcaagctaagggctcgggaattctgg
gctttgcgcaatatcagcctagaggtcaaagagggcgaaaccctgggcatcgtcggccaa
aacggctcgggcaagagcacgctgctgcaaatcatcgcgggaacgctgaccccctccgag
ggcgaggtgacggtgaatggtcgcgtggcggcgctgctggagctaggcagcggcttcaac
ccggaattcaccggtcgccagaacgtctttttcaacggccagattctggggctagcgcgc
gaagaggtggaggcaaagtttgatgcgatcgccgccttcgcggacatcggcgaattcatc
gatcagcccgtcaaaacctactccagcggcatggccgtgcggcttgcctttgcggtggtg
gcccacaccgaaccccgcatcctgattgtggatgaggccctggcggtgggcgacgccaag
ttccaggttcgctgcatgcagcggattcgccagatgaaggaccagggcgtgacgatcctg
ttcgtgtcccacgatgcgtccagcgtgaaaatgctgtgcgatcaggccatcttgctgcac
cacggcgaggcgatccgctcagggcagccccgggaggtcgtgaactactacatcgagctg
ctcaactctggcagcacccagcccgccgccgacgtctccgaaacggccacgtcaccggag
gagctggcgtcgattcgccggacgacagcagcccagggcgctgacgatgtagagctgaaa
gctcgccgctacggcaccaaattggcggtgtttcaggaaatcaaaatcaccgatgcccac
ggccaagaggcagagaagctggaaacgggcagcacctttcatatctcgatttccctagag
gcgatggcggagctgtcggacctggtcgtgggcatctcgatccgcaacctgatgggggtg
gtgatgtacggcaccaatacctaccacctcgacagcaagttgccctctctggaggccggt
cagaccatcacactgaccttccagctgccctgccagctcaatcgcggcgtctacacggtg
acggtgggggcgcactcggagggcggcctgagctacgactgggtggatgagctggtggtg
tttgaggtctacaacaccagtcagtgcgagggatttgtggatttggcgtcggaggtgcgc
tacgaagtgctgtcttcggcgctgccatcttag

DBGET integrated database retrieval system