KEGG   Geitlerinema sp. PCC 7407: GEI7407_2322Help
Entry
GEI7407_2322      CDS       T02366                                 

Definition
(GenBank) protein of unknown function UPF0061
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2855425..2856852
Genome map
AA seq 475 aa AA seqDB search
MTALNPFLTLDYEPAFESLGEDYADPVAAASFPQHLLRFRNDDLLEQLGLSADQVQDEHF
LEAFGRFEGRSPFLAMRYHGYQFGQYNPELGDGRGFLYGQVRDRQGQLQDLGTKGSGTTP
YSRTADGRLTLKGGVREVIAAEALHRMGVRTSRCLSLIETGEALWRGDEPSPTRSSVMVR
MARSHIRFGTFERLHHFQRKDLIQTLLDHVIEHYYPHLQGDADGGARFYGELVERVAELA
AQWMAAGFCHAVLNTDNMTITGESFDYGPYAFIPSYNLRFTAAYFDYFGRYCYGQQPLAC
RWNLEMLQAPLGLVLPTADLEAGLAQYFDHFQRTYERLMLRKLGFEKPAALGAIAPQLVE
ATLQLLQETQASYHGFFGGLAASFTPAWRAGDRPWPRFQDPLNDAQQHCLEQWQELYQQA
LETLPLEAMDSVKDQLQQANPATVPVRPAIEAVWEPIATEDNWLPFYELLERIRT
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctttgaacccctttttgaccctggactatgagcctgcctttgagtccctcggg
gaggactatgccgacccggtggcggcggcttcgtttccccagcatcttttacgctttcgc
aatgatgacttgctggagcagcttgggctgagcgcagatcaggtgcaggatgagcatttt
ctggaggcgtttggtcgctttgaggggcgatcgccttttttggcgatgcgctaccacggc
tatcagtttggccagtacaaccccgagctcggggacggtcggggcttcctctacggtcag
gtgcgcgatcgccagggccagctgcaagacctcggcaccaagggctccggcaccaccccc
tattcccggaccgccgacggtcgcctcaccctcaagggcggcgtgcgggaggtgattgcc
gccgaggccctgcaccgcatgggggtgagaacgtctcgatgtctgagcctgatcgaaacc
ggcgaggccctctggcggggcgatgagccctcgccgacgcgctcttcggtcatggtgcgc
atggcgcgatcgcacatccgttttggcaccttcgagcggctacaccacttccagcgcaaa
gacctgattcagacgctgctggaccacgtcatcgagcactactacccccatctccagggc
gacgccgacgggggagcgcgcttttatggcgaactggtggagcgggtggcagaattggcg
gctcagtggatggcggcgggcttttgtcacgcggtcctcaacaccgacaacatgaccatc
accggggagagcttcgactacggcccctacgcctttattcccagctacaatctgcgattc
acggccgcctacttcgactactttgggcgctactgctacggccagcagcccttggcctgc
cgctggaatctggaaatgctgcaagcgcccctgggcttggtcttgcccacggctgatctg
gaggcaggcctcgcgcaatatttcgaccatttccagagaacctacgagcgcctgatgctg
cgaaagctgggctttgagaaaccggcggcgctgggagcgatcgccccccaactggttgag
gcaacgctccagcttttgcaggagacccaggccagctatcacggattttttggcgggcta
gcggcttcctttactccggcctggcgagcaggcgatcgcccctggccccgcttccaggac
ccgctcaacgacgcccagcagcactgcctcgagcaatggcaggagctttaccagcaagca
ctagaaacgctgcccctcgaagcgatggacagcgtaaaggaccagcttcagcaggccaat
ccggcaacagtgcctgtgcggcctgcaattgaagcggtgtgggagcccattgccactgag
gacaactggctcccgttttatgagctccttgagcgaatccggacctag

DBGET integrated database retrieval system