KEGG   Geitlerinema sp. PCC 7407: GEI7407_2323Help
Entry
GEI7407_2323      CDS       T02366                                 

Definition
(GenBank) alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal allergen
  KO
K03564  
peroxiredoxin Q/BCP [EC:1.11.1.15]
Organism
gei  Geitlerinema sp. PCC 7407
Brite
Enzymes [BR:gei01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     GEI7407_2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2856849..2857286)
Genome map
AA seq 145 aa AA seqDB search
MALTTGTPAPSFTVKDTNGNTVSLSDFQGKTVVLYFYPKDDTPGCTKEACSFRDSYTAYQ
GKDIVVLGVSMDDEASHQRFTEKFSLPFPLLADVKGELTKAYDVDGGSYSKRVTYVIDGN
GTISHVYDSVKTDTHASDILADLGV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcattgaccactggaacccccgcgccgagcttcactgtcaaagacaccaacggcaac
accgtttcgctctctgacttccaaggcaaaaccgtggtgctgtacttctatcccaaagac
gatacccctggctgcaccaaagaagcttgcagcttccgcgactcctacacggcttatcaa
ggcaaggacatcgtggtcctaggcgtcagcatggatgatgaggcgtcccaccagcgcttt
accgagaaattcagcctgcccttcccgctgctggcggacgtcaagggcgaactgaccaag
gcctacgacgtggatggcggcagctactccaagcgcgtaacctacgtcatcgacggcaac
ggcaccatcagccacgtctacgactccgtcaagaccgacacccacgccagcgacatcttg
gctgatctgggcgtctag

DBGET integrated database retrieval system