KEGG   Geitlerinema sp. PCC 7407: GEI7407_2325Help
Entry
GEI7407_2325      CDS       T02366                                 

Definition
(GenBank) hypothetical protein
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2858061..2858246
Genome map
AA seq 61 aa AA seqDB search
MNNCAETCVNGCILGDKCPHLEYAQAARKFLEETSVDRMIEISEARFLPKQPEDQGSQFE
G
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
gtgaataactgtgctgaaacctgcgtgaatggctgcattttgggggacaagtgcccccac
cttgaatacgcccaagccgcgcgaaagtttctcgaagaaacgtccgtcgatcgtatgatt
gagatttctgaggcccgattcttgccgaagcagcccgaagatcagggctcccagttcgaa
ggctag

DBGET integrated database retrieval system