KEGG   Geitlerinema sp. PCC 7407: GEI7407_2326Help
Entry
GEI7407_2326      CDS       T02366                                 

Definition
(GenBank) hydrogenase accessory protein HypB
  KO
K04652  
hydrogenase nickel incorporation protein HypB
Organism
gei  Geitlerinema sp. PCC 7407
Brite
Chaperones and folding catalysts [BR:gei03110]
 Other chaperones and cochaperones
  Others
   GEI7407_2326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2858341..2859054)
Genome map
AA seq 237 aa AA seqDB search
MHQTFDAALEMNLLHANQAGADHNRAHFDGWGITCLNLMSSPGAGKTALLERTLAALQGE
MAIAVIEGDMTTELDAERLRRYGVPVIAINTGRSCHLDAKMVAGGLHQLEHAHDPRQFDL
VLVENVGNLVCPAEFEVGEHAKVALLSVTEGEDKPLKYPVMFQEADCLLITKMDLAPHLE
VDLDLLIGNVRQMNPHVTIVPVSAKTGEGLEAWLEWVRAEVARPKAAAEAPAGLGAR
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaaacctttgacgctgctcttgagatgaatttgctccacgccaaccaggcgggg
gccgatcacaatcgcgctcatttcgatggctggggcatcacctgcttgaacctaatgagc
agtcccggcgcgggcaaaacggctctgctggagcggacgctggcggcgctccagggggag
atggcgatcgccgtcatcgagggagacatgaccaccgagctagacgccgagcgactgcgc
cgctacggcgtaccggtgatcgccatcaacaccggccgctcctgccacctggacgccaaa
atggtcgcgggcggtctgcatcagctcgagcacgcccacgatccgcgccagtttgacctc
gtgctggtggaaaatgtcggcaacctcgtgtgtccggcggaattcgaggtgggagagcac
gccaaggtggcgctgctgagcgtcacggagggggaagacaagcccctgaagtacccggtg
atgttccaggaggcggactgcctgctgatcaccaagatggacctggcgccccacctggag
gttgacctggatttactcatcggcaacgtgcgccagatgaatccccacgtgaccatcgtg
ccggtgtcggcgaagacgggggaaggcctagaagcttggctggagtgggtgcgtgctgag
gtggctcgtcccaaagcggcggctgaggcgcctgcgggtttgggtgctcgctaa

DBGET integrated database retrieval system