KEGG   Geitlerinema sp. PCC 7407: GEI7407_2336Help
Entry
GEI7407_2336      CDS       T02366                                 

Definition
(GenBank) pyruvate phosphate dikinase PEP/pyruvate-binding protein
  KO
K01007  
pyruvate, water dikinase [EC:2.7.9.2]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GEI7407_2336
  Energy metabolism
   00680 Methane metabolism
    GEI7407_2336
Enzymes [BR:gei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.2  pyruvate, water dikinase
     GEI7407_2336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2866332..2869241
Genome map
AA seq 969 aa AA seqDB search
MVLNLGTGWALVVMSAIAFCLGALPLTGWWVQLATGRRLRAAGTGNLSVSAAFYHGGRWV
GIGAVVLEAAKGIGAVLVARSLLPGAPAWELVALLALVAGRYSLGRGAGTTNVVWGYIVH
DWRVAALVFLISGVSFTLMRQREQGRLVVLLLVPVILALLHPGQSGRVVAAIALSGLIAL
IYQAIPDDLDLSTSAATPESRRMFRFFRGDRGLKTLDDSLKTEVAGAKAATLAQLRRWGY
PVPFGWVILPGDDVETLVSGFQPSAATPLAVRSSAVGEDSETASAAGQYLTLLNVTSHEE
LAIAIDRCFASYDQPSASRYRSDRGLADSAMAVLVQQQVSGAFSGVAFSRDPISQQGSAV
VIEALPGPATRVVSGQVTPESYRVSVLDSDLDQATESWRLPEKLDLPVEGSGDVPMFLIQ
QVAFLARHLEKRYHGVPQDIEWTYDGQQLWLLQSRPITTLIPIWTRKIAAEVIPGAIRPL
TWSINRPLTCGVWGELFTLVLGDRARGLDFTETATLHFSHAYFNASLLGDLFLRMGLPPE
SLEFLTRGAKFSKPPLSATVRNVPGLGRLVGRELRLHKDFRREMQQHFGPAIAAFEQQPA
ETLETSALLERIDRVLLLLRRATYYSILGPLSAALRQALFKVPDQALDNRRTPEVASLQA
LGALADRVRDRLDPGALPPEQSEAIAALRRHPETADLMSQFDALVAEYGYLSEVGTDIAV
PTWREHPQTVEEIFWQFVRQGAPPAAESSQSAPQAVQQRVDLKGEVTRVYSRLLAELRWS
LMALGKRLHQQELLPSVDTLFDLTWDEVQRLAKTGSPELAAHWQSKAQRRRSQFERDRQL
PSVPQVVYGKTPPPPELSSAAPARQQFRGIGASPGEVEGRVVVLRTLRSSATLPEDAILV
VPYTDSGWAPLLAQAKGLIAEVGGRLSHGAIVAREYGIPAVMDIHEATRLLRDGQRVRLN
GQSGLVELL
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgaatcttgggactggatgggcgctggtagtgatgagcgcgatcgccttttgt
ttgggagctttgcccctgaccggatggtgggtgcagctagccacaggacggcggctgcgc
gccgctggcaccggcaacctcagcgtgtctgcggctttttatcacggggggcgctgggtt
ggcattggggcggtggtgctggaggcagccaaaggcattggggccgtgctggtggcgcga
tcgcttctgccgggggccccggcctgggagctggtggcgttgctggccctggtggccgga
cgctacagcctcgggcgcggcgcaggcacgaccaacgtggtttggggatacatcgtccac
gactggcgggtcgcggccctggttttcttgatttctggggtgagctttacgctgatgcgc
cagcgggagcaggggcgcttggtggtgctgctgctggtgccggtgattttggcgctgctc
catcccggtcagtctggtcgcgtcgtggcggcgatcgccctgagcggcctgattgccctg
atttaccaagccattcctgacgatctggacctgtctacctctgctgccacaccggagtct
cgccgtatgtttcgatttttccggggcgatcgcggcctcaaaacccttgatgattctctc
aaaaccgaggttgctggcgccaaggccgcaaccctggcccagctgcggcgctggggctac
cccgtgccctttggctgggtgatcttgccgggggacgacgtagaaaccctggtgagcggc
tttcagcccagcgccgccacgcccctggcggtgcggtcctccgccgtgggcgaggactcc
gaaacggcctcggcggcgggtcagtatctgacgctgctcaacgtcaccagtcacgaggag
ctggcgatcgccatcgatcggtgctttgcctcctacgaccagcccagcgccagccgctac
cgcagcgatcgcggcttggccgacagcgccatggccgtgctggtccagcagcaggtttct
ggggcgttttcgggggtggcctttagccgcgacccgatcagccagcagggatctgccgtc
gtgatcgaagcgctgcccggaccggccacgcgggtggtttctggccaggtgacccccgag
tcctaccgggtgagcgtcctcgacagcgacctcgatcaggccaccgagagctggcgactg
cccgaaaagctggatctgcccgtggaaggcagcggcgacgtgccgatgtttctgattcag
caggtggcatttttggcgcggcacctcgaaaagcgctaccacggcgttccccaggacatc
gagtggacctacgacggccagcagctctggctgctccagagccgccccatcacgacgctg
attcccatctggacccgcaagatcgcggcggaggtgatcccgggggcgattcgcccgctc
acctggtcgatcaaccggcccctgacctgcggagtttggggcgagctcttcacgctggtg
ctgggcgatcgcgcgcgcgggctcgacttcaccgaaaccgccacgctgcatttttcccac
gcctacttcaatgcgtccctgctgggggatttgtttctgcgcatggggctgccgccagag
agcctggagtttttgacccgaggcgcaaaattttcgaagccgcccctgagcgccacggtg
cgcaatgttcccggcctgggccgcctggtgggccgagagctgcggcttcacaaggatttt
cggcgggagatgcagcagcactttgggccggcgatcgccgcctttgagcagcagcccgcc
gagaccctggagacctcggccctcctagagcgcatcgatcgggtgctgctgttgctgcgg
cgggcaacctactacagcattctgggtcccctgagcgctgccctgcgccaggccctcttc
aaggtgccggatcaggcgctggacaatcgccgcacgccagaggtcgcgtcgctccaggcc
ctgggtgccttggcagatcgggtgcgcgatcgcctggatccaggggccttgcccccagag
cagtcagaggcgatcgcggctctgcgcagacatcccgaaacagcagacctcatgagccag
tttgacgccttggtggcggagtacggctacctaagcgaggtgggcacggacatcgccgtt
cccacctggcgcgaacatccccaaacggtggaggaaattttctggcagtttgtccgccag
ggagcgcctcccgccgctgagtccagtcagtctgccccccaagccgtgcagcagcgcgtg
gatctcaagggggaggtgacccgggtgtacagtcggctgctggcggagctgcgctggagc
ttgatggcgctagggaaacgcctgcatcagcaggagctactgcccagcgtggacaccctg
tttgatctgacgtgggatgaggtgcagcggctagccaaaacgggctcccccgagctggcc
gctcactggcaaagcaaggcccagcggcggcgatcgcaatttgagcgcgatcgccagctt
ccctcagttccccaggtcgtctacggcaaaaccccgccgcccccagagctgagcagcgcc
gccccggcccgccagcagtttcggggcattggcgccagtcctggcgaggtggaggggcgc
gtcgttgtcctgcgaaccctgcgcagcagcgccaccctgcccgaagacgccattttggtg
gtcccctacacggactccggctgggccccgctgctggcccaggccaagggcctgatcgcg
gaggtggggggccgcctgtcccacggggcgatcgtggctcgggagtacggcattccggcg
gtgatggatattcacgaggccacacggctgctgcgagacggccagcgggtccgcctcaac
ggccagagcggcctggtagagctgctctag

DBGET integrated database retrieval system