KEGG   Geitlerinema sp. PCC 7407: GEI7407_2337Help
Entry
GEI7407_2337      CDS       T02366                                 

Definition
(GenBank) Phosphinothricin acetyltransferase
  KO
K03823  
phosphinothricin acetyltransferase [EC:2.3.1.183]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Phosphonate and phosphinate metabolism
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    GEI7407_2337
Enzymes [BR:gei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.183  phosphinothricin acetyltransferase
     GEI7407_2337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2869238..2869735)
Genome map
AA seq 165 aa AA seqDB search
MQLRDAAIADLPQIVAIYNQTIPSRQVTADTEPVTVESRLAWLGDRPPHRPVWVLEDSGE
ILAWCSFQSFYGRPAYGGTAEISLYVAAAHRRRGLGRSLLQQACQRGPDLGLTTLLGFIF
AHNEPSLSLFRQMGFETWGHLPRVAVLDGVERDLVILGRRLEDPA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttcgagacgccgcgatcgccgatttgccccagattgtcgccatctacaaccag
acgattcccagccgccaggttaccgcagataccgagccagtcaccgtcgagagccgactg
gcttggctgggcgatcgcccgccccatcgcccggtctgggtcctggaggacagcggcgaa
atcctggcctggtgcagcttccagtccttttatgggcgtccggcctacggcggcaccgcc
gaaattagcctctacgttgcggcggcccatcgacgccggggtctggggcgatcgctgctt
cagcaggcctgccagcgcgggccggacctgggcctgacgaccctgctgggcttcatcttt
gcccacaacgagccgagcctgagcctctttcgccaaatgggcttcgagacctggggacac
ctgccccgagtggcggtgctcgatggcgtcgagcgagacttggtcatcctgggccgccgc
ctggaggatcctgcctag

DBGET integrated database retrieval system