KEGG   Geitlerinema sp. PCC 7407: GEI7407_2339Help
Entry
GEI7407_2339      CDS       T02366                                 

Definition
(GenBank) NHL repeat containing protein
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2870544..2872040
Genome map
AA seq 498 aa AA seqDB search
MPRVRAPELPADFPWLNFPGPLSLRSLRGRVVLLDFWTYGCINCLHVLPDLHALEQRYGD
RLQVIGIHTGKFSQEQHPASVEQAIARYGIRHPVVVDQNQYLWDQYAIKAWPTLVLIDPA
GYVVTQRAGEGHSDTFDRQIGELLAGRSPDSGAPAPEQPIASPLAFPGKVAIGAIAQENH
LFVADTGHHRLVIATLEGKVRATVGSGTPGYQDGPWETAQFRAPQGLTYDPAGDRLYVAD
TGNHLIRCVHGRSRTVTTLAGTGQQNRSLRPQQGRRLETPLNSPWDVALKGDRLFIAMAG
SHQIWVLSLTEDAVGTLLGTGAEACIDGTASEATFAQPSGLAIDGDTLYVADSESSSVRA
ISLADPPSVQTLCGSGGLFDFGDREGRGDRARLQHCLGLAHGPGNLWIADTYNHKIKRLN
LAEGHCVNIVGSGLPGHQDGWGPEASFSEPSGLASEGQTLYIADTNNHAIRRWDWATQQV
TTFCFEGLCAPHLCVPPR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgttcgtgcgcccgagctgcccgctgactttccctggctaaattttccaggc
cctttatccctgcgatcgctgcgcggtcgggtcgtcctgctggatttttggacctatggc
tgcatcaactgtctgcacgttttgccagacctgcacgccctagagcagcgctacggcgat
cgcctccaggtgatcggcatccacaccggcaagttttcccaggagcagcaccccgccagc
gtcgagcaggcaatcgcccgctacggcatccgccacccagtggtcgtcgatcaaaatcaa
tatctgtgggaccagtacgccatcaaggcctggcccaccttggtgctcatcgaccccgca
ggctacgtcgtgacccagcgggccggtgaaggccactccgacaccttcgatcgccagatt
ggcgaacttctggccgggcgatcgcccgattccggcgctcccgccccagaacagccgatc
gccagccccctggcctttccgggaaaggtggcgatcggggcgatcgcccaggaaaatcac
ctatttgtcgcagacaccggccaccaccgcctggtcatcgccacccttgagggaaaggtg
cgggccaccgtcggctcaggcactcccggctaccaagacggcccctgggaaaccgcccag
tttcgcgcgccccagggcctgacctacgatccggcgggcgatcgcctctacgtcgccgac
accggcaatcacttgattcgctgcgtccatgggcgatcgcgcaccgtcaccaccctcgcc
ggcacgggccagcaaaaccgatctctgcgcccccagcagggccgccgcctggaaaccccg
ctcaactccccctgggatgtcgccctcaaaggcgatcgcctcttcatcgccatggccggg
tcccaccagatctgggtgctctccctcaccgaagacgccgtcggcaccctgctcggaacc
ggcgccgaagcctgcatcgacggcaccgccagcgaggccacctttgcccagcccagcggc
ctggccatcgacggcgacaccctctacgttgccgacagcgaaagcagctcggttcgggcc
atttccctcgccgatcctcccagcgtccaaaccctgtgtggcagcggcggcctcttcgac
tttggcgatcgcgagggccggggcgatcgcgcgcgattgcagcactgcctcggcctcgcc
cacggccctggcaacctctggatcgccgacacctacaaccacaaaatcaagcggttgaac
ctcgccgaaggccactgcgtcaatatagtcgggagcggcctcccaggccaccaggacggc
tggggcccagaagcctctttctcggaaccttccggcctcgccagcgagggtcaaacgctg
tacatcgcagacaccaacaaccacgctatccggcgctgggactgggccacccaacaggtc
acgaccttctgcttcgaaggactttgtgctccccatctttgcgttccgcctaggtaa

DBGET integrated database retrieval system