KEGG   Geitlerinema sp. PCC 7407: GEI7407_2340Help
Entry
GEI7407_2340      CDS       T02366                                 

Definition
(GenBank) efflux transporter, RND family, MFP subunit
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2872287..2873729
Genome map
AA seq 480 aa AA seqDB search
MSQVALLTEHFRSLTPATLSRMLLIGLLIIPTAGCGFLPKEEANAQPAQRGQAEDGPAAV
DVAIARTAPLGEELEYTGTTQPFREISLRAQVEGQLVSLSADVGDPVARGQVVARLDDQV
LTAAVVGAQAEVAAQEAEVAQARTEVSDAETLVEQARLELQQAQSDLARFQGLYEEGVIP
EQQVEQARTAVGTAEQAFRSAQEQVRTRQQAVTASERRVIAQQAAVAQEQERRAYSVLTS
PIDGYVLERVTEPGNLVQPGGELLRLGDFSQVKISVQVSELELADIQTGQVVQVRLDAFP
GQALVGRVARISPAADPTARLVPVEVTIPNEGGRIGSGLLARVNFTQQAAARVVVPETAL
RANQERGPRGGARGGGRPAGGPPGGASQRPSESPQPLQAGDRGTIFVVAGSGDAATVEER
TVTVGDRRDGRVEIIAGLEPGEAFVARSSQGLKDGETVRTSVLSEEAPAQGSGASRSQDP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaggttgccctattgactgagcattttcgttctctcacaccggcgaccctctct
cggatgctgttgatcgggttgctgatcatcccaacggccggctgcggctttttgcccaaa
gaggaggccaacgcccagcccgctcagcggggccaagccgaagatggtcccgcagccgtg
gatgtggcgatcgcccgtactgcccccctcggtgaggaactggaatacaccggcaccacc
cagccctttcgggaaatttccctgcgcgcccaggtcgaagggcagctggtgagcctcagc
gccgatgtgggagaccccgtggcccgaggccaagtggttgctcgtctcgatgaccaggtc
ttgaccgcagcggtcgtcggggcccaggccgaggtcgccgcccaggaagccgaggtcgcc
caggcccgcacagaggtcagcgatgccgaaaccctggtcgaacaagctcgcctagagctg
cagcaagcccagtccgatctcgctcgcttccagggtctgtacgaggagggcgttattcca
gagcagcaggtcgagcaggctcgcaccgctgtcggcacggcagagcaggcttttcggtcg
gcccaagagcaggtgcgcacgcgccagcaggcggtgaccgcctcggagcggcgggtgatc
gcccagcaggccgccgtcgcccaagagcaggagcggcgggcctattcagtgctgacatct
cccatcgatggctatgtccttgagcgggtgactgagccaggaaacttggtccagcccgga
ggggaactgctccgattgggagactttagtcaggtcaagatttcggtccaagtgtctgag
ctggagctggccgacattcagacaggacaggtagtccaagtccggcttgatgcttttccg
ggccaggcactggtcggtcgggtggcgcgaatctctcccgcggcggacccgacggctcgc
ttggtgccggtggaggtgaccattcccaatgagggtggacgcatcggcagcggtctcctg
gcgcgggtgaatttcacgcagcaggcggcggcccgcgtggtggtgcctgaaacggctctc
cgggccaaccaggagcgggggcctcgcggcggcgctcgcggcgggggcagacccgctgga
gggccgcccgggggagccagtcagcgccccagcgaatccccccagccgctgcaggcgggc
gatcgcggcacgatttttgtggtggcgggctcgggagatgcggccacggtggaggagcgg
accgtcacggtgggcgatcgccgggatggccgcgtggagatcattgcgggcctcgagccc
ggagaagcttttgtggcccgcagtagccagggcctcaaggatggcgagacggtccggacc
agtgtcctgtcagaggaggcacctgcgcagggctcgggagcatcccgctcccaggaccca
tga

DBGET integrated database retrieval system