KEGG   Geitlerinema sp. PCC 7407: GEI7407_2389Help
Entry
GEI7407_2389      CDS       T02366                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GEI7407_2389
Enzymes [BR:gei01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     GEI7407_2389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2925024..2927066
Genome map
AA seq 680 aa AA seqDB search
MSVLSRSAPLTFPLAAVVGQEAIKVALLLSAVDPGLGGIIISGRRGTAKSVMARAIHALL
PPIEIVQGSLNCDPNLPSEWDDQTAAEYGDRPTEAPTQVVPAPFVQVPLGVTEDRLLGSV
DVAQSIKRGETVFQPGLLAEGHRGVLYVDEINLLDDQIANLLLGALSDGRNQIEREGISV
QHPCKPILIATYNPEEGALREHVLDRFAIALSADMVLGLDDRVAAVEQATSYANSPTAFL
EQYEEDTESLKTQIILAREWLKDVQISQDQITYLVNEAVRGRVQGHRAELFAVRVAKASA
ALDGRTQVSADDLRRAVELVIIPRATVIETPPEEQPPPPPPPPPANQDNPDEPTDQDQDE
DDQTEDESENEDTEEPEDPPSVPEEFVFDPEGVILDPTVLYFAQMAQRRGKSGARSLMFT
EDRGRYVKPMLPKGPVRRIAVDATLRAAAPYQKARRLRNPERRVIVEQPDIRSKRLARRS
GALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQSRDQVALIPFRGEQAEVLLPPTRSI
ASARRRLDRLPCGGGSPLAHGLTQAVRVGMNAQQTGDVGQVVIVAITDGRGNIPLARSLG
EVMMEGEKPDIKGELLEIAGRIRGLGIQLLVIDTENKFISTGFAKELAKTAGGKYYHLPK
ATDQAIASMTRSAIADMKAR
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgctcagtcgctctgcacccctaacctttcccctcgcagccgtcgtcggccag
gaagcgatcaaggtcgccctgctgctgtcggcggtggatccaggccttggcggcatcatc
atttcgggtcgacgcggcacggccaaatccgtgatggcgcgcgcaattcacgccctgctg
ccccccatcgaaatcgtccaaggctccctcaactgcgatcccaacctgccctcggaatgg
gacgaccaaaccgccgctgagtatggcgatcgccccaccgaagcgccgacccaagtcgtt
ccggctccctttgttcaggtgccgctgggcgtcaccgaggaccgcttgctgggctctgtg
gacgtcgcccagtccatcaagcgcggcgaaaccgtctttcagccaggactgctggccgaa
ggccaccgaggcgtcctctacgttgacgaaatcaacctcctcgacgaccaaatcgccaac
ctgctgctgggcgccctcagcgacggccgcaaccagatcgagcgagaaggcatcagcgtc
cagcacccctgcaagccgatcctgattgccacctacaaccccgaggaaggggcgctgcgg
gagcacgtcctcgaccgatttgcgatcgccctctccgccgacatggtgctgggcctcgat
gatcgggtggccgccgtcgagcaggccaccagctacgccaactcccccaccgccttcctc
gagcagtacgaagaagacaccgaaagtctcaaaacccaaatcatcctggcccgcgagtgg
ctcaaggatgtccagatttcccaagaccaaatcacctacctggtgaacgaggccgtgcgc
ggtcgcgtccagggacaccgggccgagctcttcgccgtgcgggtggccaaggccagcgcc
gccctcgatggccgcacccaggtcagcgccgacgacctgcgacgggccgtcgagctggtg
attattccccgggcaacagtcatcgagacgccgcccgaggagcagccaccgccaccgccg
ccgccaccccctgccaaccaggacaacccggacgagcccaccgaccaagatcaggacgag
gacgatcaaaccgaggacgagagcgaaaacgaggacaccgaggagcccgaagaccccccc
agcgttccagaagaatttgtttttgacccggagggcgtgattctcgatccgacggtcctg
tacttcgcccagatggcccagcggcgcggcaagtcgggggctcgcagcctcatgtttacc
gaggaccggggccgctacgtgaagcctatgctgcccaaggggcctgtgcggcgcatcgca
gtggacgccaccctgcgcgccgccgccccctaccaaaaggcgcggcgcctgcgcaacccg
gagcgccgggtgatcgtggagcagcccgacattcgctcgaagcggctggcgcggcgatcg
ggcgcgctggtggtctttgtggtggatgcatcgggatccatggccctgaaccggatgcag
tcggctaagggcgcagtgatgcagctgctcaccgaggcctaccagagccgcgaccaggtg
gccctgattcccttccggggcgagcaggccgaagtgctgctgccccccacgcgatcgatc
gcgtcggcgcggcgacgtctggaccggctgccctgcggcggcggttcgcccctggcccac
ggcctgacccaggccgtgcgggtcggcatgaatgctcagcaaaccggggacgtaggccag
gtggtgatcgtggccattaccgacgggcgggggaatatcccgctggcgcgctccctgggc
gaggtgatgatggagggcgaaaagccagacatcaagggcgagctgctggagatcgcggga
cgcattcgcggcctgggtatccagctgctggtcatcgacaccgagaataagttcatctcc
acgggatttgccaaagagctggccaaaaccgccggcggcaagtactatcacctgccgaag
gcaacggatcaggcgatcgcctctatgactcgcagcgcgatcgccgacatgaaagcgcgc
tag

DBGET integrated database retrieval system