KEGG   Geitlerinema sp. PCC 7407: GEI7407_2737Help
Entry
GEI7407_2737      CDS       T02366                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GEI7407_2737
Enzymes [BR:gei01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     GEI7407_2737
Transporters [BR:gei02000]
 Other Transporters
  Pores ion channels [TC:1]
   GEI7407_2737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_6 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AFY67210
UniProt: K9SAN0
Position
complement(3354591..3355151)
Genome map
AA seq 186 aa AA seqDB search
MLKLYGGARSRASIVQWYLEELGLPYEFVMLDMQAGEHRQPAYLAINPVGKVPAIVDGDY
VLWESGAILLYLAEKYGPGTTPETRGTLAQWVSFANATLGPGLLNESLREKEAPRLLGAV
ETVLAQHPYLAGQELTVADVAVGATLAYMQLFVGLTYGDYPAIADYLTRITDRPAYQKAI
GIRYQA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaagctgtatggcggggcgcgcagtcgcgcctcaattgtccagtggtatctggaa
gagctgggtcttccctacgagttcgtaatgctagacatgcaggcgggagagcatcgccag
cccgcttatctggcgatcaacccggtgggcaaagtgcctgcgatcgttgatggggactat
gtcctgtgggaatcgggcgcgatcttgctctatctggccgagaagtatggcccgggcacg
actcccgaaacgcgcggcacgctggcccagtgggtgagctttgccaatgcgactctgggc
ccgggcctgctcaatgaatctctgcgcgaaaaagaagcgccgcgcttgctgggcgcagtc
gaaacggtccttgctcagcatccctatctcgcaggacaggagctgacggttgcagacgtt
gcggtgggcgcgaccctggcctacatgcagctttttgtgggcctgacctatggcgactat
ccggcgatcgccgactacctgacccgcatcaccgatcggcctgcctaccagaaagccatc
ggcattcgctaccaagcttag

DBGET integrated database retrieval system