KEGG   Geitlerinema sp. PCC 7407: GEI7407_2769Help
Entry
GEI7407_2769      CDS       T02366                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GEI7407_2769
Enzymes [BR:gei01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     GEI7407_2769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3386839..3388344
Genome map
AA seq 501 aa AA seqDB search
MDFPRSSGILLHPTSLPGRFGIGDMGPAAYEFVDFLVASGQQIWQVLPLGPTGYGNSPYL
SYSAAAGNPLLISLEVLQQAGHLSEADLAQLPEFPADTVDFDRVIATKFPLLRLASDHFR
DHASPEERGEFEAFCGDESYWLDDYAFFMALKDAHGDLPWNQWDEAIARRDPAALEEWRS
RLANDIFFRQYTQFEFFRQWAKLRAYANQQRILIVGDIPFYVAHDSADVWAQPDNFCLDE
ETGAAALMAGVPPDYFSATGQLWGNPVYNWEHLEAQGFQWWVQRFKALLRYVDVIRIDHF
RGFEAYWAVPMGEETAVNGEWIKAPGETFFQVLGDRLGKLPIVAEDLGVITPEVEALRDQ
FGFPGMKILQFAFGSGPGNPYLPFNYQGSKWIVYTGTHDNNTTLGWFSQCGHHEKEGLLH
YLGCTGPHGIHWDMIRLALSSTACQAIIPLQDVLGLGSEGRMNTPSESHGNWGWRYHAGA
LTPELRDRLRGMTETYGRLPH
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggattttcctagatcaagcggtatcttgctgcatccgacgtccctgcccggccgcttt
ggcattggcgatatgggacctgcagcgtacgaatttgtcgatttcttagtagccagcggt
cagcagatttggcaggtgttgcccctaggccccaccggctacggcaactcgccttatctg
tcctactcagcagcggccggcaacccgctgctaatcagcctcgaggtgttgcagcaggca
gggcacctcagcgaggcggatctggcccagctgcccgaatttccggcagacactgtggac
ttcgatcgggtgattgccaccaagtttccgctgctgcgtctggccagcgaccattttcga
gatcacgcatctccagaggaaaggggcgaatttgaggccttctgcggtgacgaaagctat
tggctagatgactacgccttcttcatggcgctgaaggacgcccacggcgatctgccctgg
aaccagtgggatgaggcgatcgcccgccgcgaccccgccgctctagaagaatggcgatcg
cgccttgccaacgacattttcttccggcagtacacccagtttgagtttttccggcagtgg
gccaagctgcgggcctacgccaaccagcaacgaattttgattgttggagatattcccttc
tacgtcgcccacgacagcgcagacgtttgggctcaaccggacaacttctgcctcgatgag
gaaacgggggcagcggctctgatggcgggcgttccgccagactatttcagcgccaccggt
cagctctggggcaacccggtctacaactgggagcatctggaggctcagggctttcagtgg
tgggttcagcgcttcaaggcgcttctgcgctacgtcgatgtgattcgcattgaccacttc
cggggcttcgaggcctactgggccgtccccatgggcgaggaaactgccgtcaacggcgag
tggatcaaggcccccggcgagacctttttccaggtgttgggcgatcgccttggcaagctg
ccgatcgtggccgaagatttgggcgtgatcacccccgaagtagaggcgctgcgggatcag
ttcggcttcccaggcatgaagattttgcagtttgcctttgggtccggccccggcaacccc
tacctgcccttcaactaccagggctccaagtggatcgtgtacaccggcacccacgacaac
aacaccaccttgggctggttctcccagtgcggccaccacgagaaggaaggcctgctgcac
tatctgggctgcactggcccccacggcatccactgggacatgattcgcttggccctcagc
tccactgcctgccaagccatcatcccgcttcaggacgtcttggggctgggcagcgaaggc
cgcatgaacacgccgagcgagagtcatggcaactggggctggcgctatcacgctggcgcg
ctgacgccagaattgcgcgatcgcctgcgcggcatgaccgagacctacggccgcctgccc
cactag

DBGET integrated database retrieval system