KEGG   Geitlerinema sp. PCC 7407: GEI7407_2878Help
Entry
GEI7407_2878      CDS       T02366                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00260  Glycine, serine and threonine metabolism
gei00750  Vitamin B6 metabolism
gei01100  Metabolic pathways
gei01110  Biosynthesis of secondary metabolites
gei01120  Microbial metabolism in diverse environments
gei01230  Biosynthesis of amino acids
Module
gei_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GEI7407_2878
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GEI7407_2878
Enzymes [BR:gei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GEI7407_2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NinF DUF2616
Motif
Other DBs
NCBI-ProteinID: AFY67349
UniProt: K9SC48
Position
3542494..3543798
Genome map
AA seq 434 aa AA seqDB search
MTQTADRQAQTRTATFSGLKCKECGAEYEPQAIHVCEQCFGPLEVAYDYNAIRSLVSRES
IQAGPNSIWRYRAFLPVETDTPIDVGTGMTPLLQANRLARRLGLKKLYIKNDAVNMPTLS
FKDRVVSVALTRARELGFSTVSCASTGNLANSTAAIAAHAGLECCVFIPADLEAGKVLGT
VIYGPTVMAVEGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGYEVAEQLGWEL
PDHIVAPLASGSLFTKIYKGFREFVEVGLVEDKHVRFSGAQAEGCSPIAQAFQEGRDFIK
PVKPNTIAKSIAIGNPADGVYAVDIAQKTNGNIESVTDAEIIEGMKLLAETEGIFTETAG
GTTIATLKKLVEAGKISPDETTVVYITGNGLKTQEAVQGYVGEPLTIEPKLESFERALER
AQTLDRLEWQQVLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaacagccgatcgtcaagctcaaacccggaccgctaccttctccggcctcaag
tgcaaagagtgcggcgctgagtatgagccccaggcaattcacgtttgtgagcagtgtttc
ggtcccttggaagtcgcttacgactacaacgccattcgtagcctcgtcagccgcgaaagc
atccaagccggccccaactccatctggcgctaccgtgcatttctgcccgtcgagaccgac
actcccatcgacgtgggcaccggcatgacgcccctgctccaagccaatcgcctcgcgcgc
cggttgggtctcaaaaagctttacatcaagaacgacgcggtcaacatgcccaccttgagc
ttcaaggatcgggtggtctccgtggccctgacccgagctcgggaactgggtttcagcacg
gtttcctgcgctagcacgggcaacctcgccaactctacagcggcgatcgcagcccacgca
ggcctagagtgctgcgtcttcattcccgccgacctcgaagccggtaaggtcctgggcacc
gtgatctacggtcccaccgtcatggccgtcgagggcaactacgaccaggtgaaccgcctg
tgctccgaagtcgccaacacccacggatggggcttcgtcaacatcaacctgcgcccctac
tactccgagggctccaagaccctgggctacgaagtcgctgagcagctcggctgggaactg
cccgaccacatcgtggcgcccctcgcttcgggctctctgttcaccaagatctacaagggc
ttccgggaatttgtggaggtcggtctggtcgaggacaagcacgtgcgctttagcggtgct
caggccgagggctgctcgccgatcgcccaagccttccaggaaggccgcgacttcatcaag
ccggtgaagcccaacactatcgcaaagtcgatcgccatcggcaaccccgcagacggcgtc
tacgcagtggacatcgcccaaaagaccaacggcaacatcgagtctgtgaccgacgccgag
atcatcgagggcatgaagctcttggccgagaccgagggtatcttcaccgagacggcaggc
ggcaccaccatcgcaaccctcaagaagctggtggaagctggcaaaatcagccccgacgaa
accaccgtggtctacatcacgggcaatggcctcaagacccaagaagcggtccagggctat
gtgggcgagccgctgaccatcgagccgaagctcgagagctttgagcgggcgctggagcga
gctcaaaccctcgatcgcctggagtggcagcaagttttggtgtaa

DBGET integrated database retrieval system