KEGG   Geitlerinema sp. PCC 7407: GEI7407_3045Help
Entry
GEI7407_3045      CDS       T02366                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00900  Terpenoid backbone biosynthesis
gei01100  Metabolic pathways
gei01110  Biosynthesis of secondary metabolites
gei01130  Biosynthesis of antibiotics
Module
gei_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GEI7407_3045
Enzymes [BR:gei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     GEI7407_3045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N XPC-binding
Motif
Other DBs
NCBI-ProteinID: AFY67515
UniProt: K9SBI6
Position
3747294..3748241
Genome map
AA seq 315 aa AA seqDB search
MRAYALKAPAKVNLYLEIIGDRPDGYHELAMILQGIELSDFVYLRSLSTDEIRLRCNHPQ
VPTDRTNLAYRAAELMVQQFPDAMAQRGGVEITIDKRIPVAAGLAGGSSNAAAVLVGLDL
LWDLGLTQIELQDLGAKLGSDVPFCIGGGTALATGRGEQLSELLNPAPLYVVLGKYRSLS
VSTAWAYGTYRREFGDQYVSGPAALQERWHRVHSGPLVKAIAGGHSTQIGPLLYNDLERV
VLPAHPQVQHLREVLGSHPEVLGAMMSGSGPTVFALTASEASAEAVREATRQAIADPDLE
LWVTRFCSHGIQVTE
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcctacgccctaaaagctcccgccaaagtcaatctctatctggaaatcattggc
gatcgccccgatggctaccacgagctggccatgattctccagggcatcgagctctcggac
tttgtgtacctgcgatcgctgagcaccgacgaaattcgcctgcgctgcaaccatccccaa
gtccccaccgatcgcaccaacctggcctatcgggccgccgagctgatggtgcagcagttt
cctgacgccatggcccagcgcggcggcgtcgaaatcaccatcgacaagcgcattccggtg
gctgcgggcctagcgggaggttccagcaacgccgccgccgtcctcgtggggctcgatctg
ctgtgggatctgggcctgacccaaatcgagctgcaagacctgggggccaagctgggctcc
gatgtgcccttttgcattgggggcggcaccgctctggcgaccggtcggggcgagcagctc
tctgagctgctcaatcctgcgcccctgtacgtcgtgctggggaaatatcgcagcctgtct
gtgtccaccgcctgggcctacggcacctaccgccgcgagtttggcgaccagtacgtgtct
gggcctgcggcgctccaggagcgctggcacagggtccactctggccccctggtcaaggcg
atcgcgggcggccacagcacccagatcgggccgcttctctataacgatctggagcgggtg
gtgctgccggcccatccccaggtgcagcacctgcgggaggtcctagggagccaccccgaa
gtcttgggagcgatgatgtccggttcggggccgacggtgtttgcgctgacggcgtccgaa
gcgtcagcggaggcggtgcgagaggcgacgcgtcaggcgatcgccgaccccgatctcgag
ctttgggtgacgcgcttttgcagccacggcatccaggtgaccgagtag

DBGET integrated database retrieval system