KEGG   Geitlerinema sp. PCC 7407: GEI7407_3045Help
Entry
GEI7407_3045      CDS       T02366                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GEI7407_3045
Enzymes [BR:gei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     GEI7407_3045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3747294..3748241
Genome map
AA seq 315 aa AA seqDB search
MRAYALKAPAKVNLYLEIIGDRPDGYHELAMILQGIELSDFVYLRSLSTDEIRLRCNHPQ
VPTDRTNLAYRAAELMVQQFPDAMAQRGGVEITIDKRIPVAAGLAGGSSNAAAVLVGLDL
LWDLGLTQIELQDLGAKLGSDVPFCIGGGTALATGRGEQLSELLNPAPLYVVLGKYRSLS
VSTAWAYGTYRREFGDQYVSGPAALQERWHRVHSGPLVKAIAGGHSTQIGPLLYNDLERV
VLPAHPQVQHLREVLGSHPEVLGAMMSGSGPTVFALTASEASAEAVREATRQAIADPDLE
LWVTRFCSHGIQVTE
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcctacgccctaaaagctcccgccaaagtcaatctctatctggaaatcattggc
gatcgccccgatggctaccacgagctggccatgattctccagggcatcgagctctcggac
tttgtgtacctgcgatcgctgagcaccgacgaaattcgcctgcgctgcaaccatccccaa
gtccccaccgatcgcaccaacctggcctatcgggccgccgagctgatggtgcagcagttt
cctgacgccatggcccagcgcggcggcgtcgaaatcaccatcgacaagcgcattccggtg
gctgcgggcctagcgggaggttccagcaacgccgccgccgtcctcgtggggctcgatctg
ctgtgggatctgggcctgacccaaatcgagctgcaagacctgggggccaagctgggctcc
gatgtgcccttttgcattgggggcggcaccgctctggcgaccggtcggggcgagcagctc
tctgagctgctcaatcctgcgcccctgtacgtcgtgctggggaaatatcgcagcctgtct
gtgtccaccgcctgggcctacggcacctaccgccgcgagtttggcgaccagtacgtgtct
gggcctgcggcgctccaggagcgctggcacagggtccactctggccccctggtcaaggcg
atcgcgggcggccacagcacccagatcgggccgcttctctataacgatctggagcgggtg
gtgctgccggcccatccccaggtgcagcacctgcgggaggtcctagggagccaccccgaa
gtcttgggagcgatgatgtccggttcggggccgacggtgtttgcgctgacggcgtccgaa
gcgtcagcggaggcggtgcgagaggcgacgcgtcaggcgatcgccgaccccgatctcgag
ctttgggtgacgcgcttttgcagccacggcatccaggtgaccgagtag

DBGET integrated database retrieval system