KEGG   Geitlerinema sp. PCC 7407: GEI7407_3433Help
Entry
GEI7407_3433      CDS       T02366                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GEI7407_3433
Enzymes [BR:gei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     GEI7407_3433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4192904..4193380
Genome map
AA seq 158 aa AA seqDB search
MQLAAIALGSNLGESQQILEAALASLDAMPNIQVTARSPWYRTAPVGPPQPDYLNGCALL
ATTLEPEALLDVLLATEAQFGRVRTTRWGARTLDLDLLLMGDRILDTPRLQLPHPRLTER
AFVLVPLAAIAPDWVEPRSGRAIADWVQAVDCSGVQQL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgcagctagcggccattgccctgggcagcaacctgggcgagtcccagcaaattttagaa
gcggctctcgcaagtctcgacgcgatgcccaacatccaggtcaccgcgcgatcgccctgg
taccgcacagcccccgtcggcccgcctcagcccgactacctcaacggctgcgccctccta
gcaaccaccctcgaaccggaggccctgctcgacgtcctgctggccaccgaagcccagttt
ggccgagtgcgcacgactcgctggggggcgcgcaccctcgatctagatttgctgctgatg
ggcgatcgcattctggatacgccgcggctccagctgccccacccccgcctcaccgagcgg
gcctttgtgctggtccccctagcggcgatcgccccggactgggtcgagccgcgctctgga
cgggcgatcgcggattgggtgcaagcggtagactgttcaggtgtgcagcaactgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system