KEGG   Geitlerinema sp. PCC 7407: GEI7407_3461Help
Entry
GEI7407_3461      CDS       T02366                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GEI7407_3461
Enzymes [BR:gei01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     GEI7407_3461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4222162..4223214
Genome map
AA seq 350 aa AA seqDB search
MSTSTDRLQSYDPSGIGVDNGNLYGLPFDYDSAQTIVFGVPWEVTVSYGAGTAQGPRAVL
EASRQLDLYDFDHPEGWRSGIFMQEIPAAIAHQSDTLRQQAARIIDHLEQGQPLESDPAL
VQLLQQINQACEGMNQWLYGETKRAIAGGKRVGVIGGDHSVPLGYLRALAEHHSDFGILH
IDAHADLRDAYEGFQYSHASIMFNALQIPQISKLVQVGIRDVCHDEVQRVQQSGDRIVSY
YDPLLKSKGYAGIPWRDLCRDIVAELPQKVYVSFDVDGLDPKLCPHTGTPVPGGLELEEA
FCLFRELVHSDRQIIGFDVCEVGNDEWDGNVGARAVYKLCNLMSLSHTKA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctcaaccgatcggctccaaagctacgaccccagcggtatcggcgttgataat
ggcaatctctacgggctgccctttgactacgacagcgcccaaaccatcgtgtttggggtg
ccctgggaggtgacggtttcctacggcgcaggcacggcccaaggccccagggcggtcctg
gaggcctcgcgccagctcgatctgtacgatttcgaccatccggagggctggcgcagcggc
atctttatgcaggagattccggcggcgatcgcccaccagagcgacaccctccgtcagcag
gcggcccggatcatcgaccacctcgaacagggccagcccctcgagagcgaccccgcgctg
gtacagctcctccagcagatcaatcaagcctgcgaggggatgaatcagtggctctatggg
gaaaccaaacgggcgatcgcgggcggcaagcgagtgggagtgatcggcggcgatcacagc
gtgcccctgggctatctgcgcgccctggccgagcaccattctgactttgggattttgcac
atcgacgcccacgccgacctgcgggacgcctacgaaggcttccagtactcccacgcctcg
atcatgttcaatgccctccagattccccagatttccaagctggttcaggtggggattcgg
gatgtgtgccacgacgaagtgcagcgagtgcagcagtccggcgatcgcatcgtcagctac
tacgatcccctgctcaagtccaagggctacgctggcatcccctggcgcgacctgtgccga
gacatcgtcgctgagctaccccaaaaggtctacgtcagcttcgatgtggacggcctcgac
cccaagctctgtccccacaccggcactccagtccccggcggcctcgagctagaggaggcc
ttttgcctgtttcgggagctggtgcacagcgatcgccagattatcggattcgacgtttgc
gaagtgggcaacgacgaatgggacggcaacgtcggtgcccgagcggtttacaagctctgc
aacctcatgagcctgtctcacaccaaagcctaa

DBGET integrated database retrieval system