KEGG   Geitlerinema sp. PCC 7407: GEI7407_3536Help
Entry
GEI7407_3536      CDS       T02366                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GEI7407_3536
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GEI7407_3536
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GEI7407_3536
Enzymes [BR:gei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GEI7407_3536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4303789..4304901
Genome map
AA seq 370 aa AA seqDB search
MTLSLSTANSQSSSAPLRAQNWPGLIEAYRPYLPVSDQTPVITLLEGSTPLIPAPAIADR
IGRQVKVYVKYDGLNPTGSFKDRGMTMAISKAKEAGAEAVICASTGNTSAAAAAYARRGG
LRAFVLIPDGYVALGKLAQALLYGAEVLAIQGNFDRALEIVRGMAESYPITLVNSVNPYR
LEGQKTAAFEVVDVLGDAPDWLCIPVGNAGNITAYWMGFCQYHQENRCTRLPRMMGFQAA
GSAPLVAGSVVEHPETVATAIRIGNPANRDRAIAVRDASQGQFDAVTDDEILEAYRILAS
EEGVFCEPASAASVAGLLKHKDQVPTGATIVCVLTGNGLKDPDSAIKFSGNQFKQGIAPD
LGAVAQAMGF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgactctaagcctgtcaactgccaactcccaatcttccagtgctccgctccgggctcaa
aactggccgggactcatcgaagcgtatcgtccctatttgccggtgagcgaccagacgccc
gtgatcacgctgctcgaaggcagcacgccgctgatccctgcccctgcgatcgccgatcgc
attggtcgccaggtgaaggtgtatgtcaaatacgacggcctcaatcccaccggcagcttc
aaagaccgggggatgaccatggcgatttccaaggccaaggaagcaggcgctgaggctgtc
atctgtgcgagcacgggcaacacgtcggcggcggcagcggcttatgcccggcggggcggc
ctgcgcgcctttgtactgatccccgatggctacgtggcgctggggaaactggcccaggcg
ctgctctacggagccgaggttctggcgatccagggcaactttgaccgggcgctggagatc
gtgcgcggcatggccgagagctatcccatcacgctggtgaactcggtcaatccctatcgt
ctagaaggccagaaaacggcagcctttgaggtggtggacgtgctgggagatgcacccgat
tggctgtgcattccggtgggcaacgcgggcaacatcacggcctactggatgggcttttgc
cagtaccaccaagaaaatcgctgcacgcgcttgccccgcatgatgggcttccaggcggcg
ggctcagcgcccttggtggcgggctcggtggtggagcatcccgagacggtggccacggcc
attcgcatcggcaacccagccaaccgcgatcgcgcgatcgccgtgcgggatgccagtcag
ggacagtttgacgcggtaaccgacgacgagatcctagaggcctatcgtattctggcttcc
gaggaaggggtcttctgcgagccagccagcgcggcctcagtggccggcctgctcaagcac
aaagatcaggtgcccacgggcgcgacgatcgtgtgcgtgctgaccggcaatggcctgaag
gaccccgactcggcaatcaagtttagcggcaaccagttcaagcagggaattgcgcctgac
ctaggggcggtagctcaggcgatgggtttctag

DBGET integrated database retrieval system