KEGG   Geitlerinema sp. PCC 7407: GEI7407_3650Help
Entry
GEI7407_3650      CDS       T02366                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00330  Arginine and proline metabolism
gei00332  Carbapenem biosynthesis
gei01100  Metabolic pathways
gei01130  Biosynthesis of antibiotics
gei01230  Biosynthesis of amino acids
Module
gei_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GEI7407_3650
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    GEI7407_3650
Enzymes [BR:gei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GEI7407_3650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFY68117
UniProt: K9SBW0
Position
complement(4449531..4450643)
Genome map
AA seq 370 aa AA seqDB search
MSQTLVVKIGTSSLTRPETGELALSTIAGVVEVLSALRREGHRVVLVSSGAVGVGCARLG
LVERPRAIALKQAVAAVGQGRLMRVYDDLFTTLQQPIAQVLLTRGDLAQRSRYVNAYQTF
RELLNLGVIPVVNENDTVAVDELKFGDNDTLSALVASLIEADWLFLLTDVDRLYSADPRR
FPDAQPITLVTRMEELHELQVQTGDRGSAWGTGGMVTKITAAQIATSAGIRTVITEGKTP
QNIVKILQGEALGTQFAPQPQPVNARKRWIAHGLISAGKLYLDGGAVAAIAEAGKSLLAA
GIVEIEGEFQAQDAVQLCDRSGKEIARGLVNYASTDLQKILGRRSEEISAILGAECPETV
VHRDNLVLLS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaactcttgtcgtcaaaatcggtacgtctagcctcactcgccctgaaacgggt
gagctggccctgtccaccatcgcgggcgtggttgaggtcctgagcgctttgcggcgcgag
gggcaccgggtggtgctggtgtcgtcgggggcagtgggcgtcggctgcgcgcggctggga
ctggtggagcggccgcgggcgatcgccctcaagcaggcggtggcggcggtgggccaggga
cgcctgatgcgcgtctatgacgacctctttacgaccttgcagcagcccattgcccaggtc
ttgctgacgcggggggacttggcccagcgcagccgctacgtgaacgcctaccaaaccttt
cgggagctgctcaatctgggcgtcattccggtggtgaatgaaaatgacaccgtggcggtc
gacgagctgaagtttggcgacaacgacaccctctcggccctggtggcgagcctgatcgag
gcggactggctgtttttgctgacggatgtggaccggctgtattcggcggatccgcggcgc
tttccggatgcgcagcccatcacgctggtgacgcggatggaggagctgcacgaactgcag
gtgcagacgggcgatcgcggttcggcctggggcacgggcggcatggtcaccaagattacg
gcggcccagatcgccaccagcgcgggcattcgcacagtgatcaccgagggcaaaacgccc
caaaacatcgtgaaaattttgcagggagaggcgctgggcacccagtttgcgccccagccc
cagccagtcaacgcccgcaagcgctggattgcccacggcctgatttcggcgggcaagctg
tacctggacgggggcgcggtggcggcgatcgccgaagccggaaagtcgctgctggcggcg
ggcatcgtcgaaatcgaaggggagtttcaggcccaggatgcggtgcagctgtgcgatcgc
tccggcaaagaaatcgcccgcggcctcgtcaactatgccagcaccgatctccaaaagatc
ctggggcgtcgctctgaggaaatttcggcgattttgggggctgagtgccccgaaacggtc
gtccaccgggacaatttggtgctgctgagctag

DBGET integrated database retrieval system