KEGG   Geitlerinema sp. PCC 7407: GEI7407_3672Help
Entry
GEI7407_3672      CDS       T02366                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GEI7407_3672
Enzymes [BR:gei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GEI7407_3672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4477056..4477979)
Genome map
AA seq 307 aa AA seqDB search
MAVVVFGSINLDLVTRSPRLPRPGETLLGSAFAMVPGGKGANQAVAAARLGAVTHLVGRL
GADLFGDRLQADLEAAGVQTAGVFRDDMAQSGVAAIALDEAGENHIIVVPGANGRLDQTD
CDRLRPLLAEASVLLLQLEIPLEAAIAAARMAHAQGVTVILDPAPAPAALPAALYPCLDF
LTPNQTEAAQLVGFGLDTPEAVVAAAQALRSRGVGTVILKLGGQGAYCLSDGGGLWLPAF
PVQPVDTVAAGDAFNGALAAALDQGLSLSEALRWAMAAGAIAVTQTGAQSAMPNQAMLKD
FLRQQAS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgtcgtgtttggcagtatcaacctggacctagtgacgcgatcgccccgcttg
cctcggcccggtgagaccttgctgggctcggcatttgccatggtgcccggcggcaagggc
gccaatcaggctgtggcggcggcgcgcttgggggcggtgacccatctggtggggcggctg
ggcgcggatctctttggcgatcgcctgcaagcggacctggaggctgcgggtgtccaaacg
gcgggtgtttttcgggacgacatggcccagtctggggtggcggcgatcgccctcgacgag
gctggcgaaaaccacattatcgtggtgcccggcgccaatggccgcctggatcagaccgac
tgcgatcgcctgcggcccctgctggcggaggccagcgtcctgctgctccagctcgaaatc
cccctagaagctgcgatcgccgctgcgcgcatggcccacgcccaaggcgtaacggtgatt
ctcgacccggccccagcgcccgccgcactccctgccgcgctctatccctgcctggatttc
ctgacccccaaccaaaccgaagccgcccagcttgtgggctttggcctggacacgccggag
gccgtcgtcgccgccgcccaagcgctgcgatcgcgcggcgtgggcaccgtgattctcaag
ctgggcggccagggtgcctactgcctgtccgacggtgggggcctctggctgcccgcgttt
ccggtccagcccgtggacaccgtggcggcgggggatgccttcaacggggccctggcggcg
gccctcgatcagggattatccctcagtgaggctctgcggtgggcgatggctgcgggggcg
atcgccgtcacccagaccggcgcccagagcgccatgcccaaccaagcgatgcttaaagat
ttcttgcgccaacaggcctcctag

DBGET integrated database retrieval system