KEGG   Geobacter sp. M21: GM21_0015Help
Entry
GM21_0015         CDS       T00933                                 

Gene name
hemE
Definition
uroporphyrinogen decarboxylase (EC:4.1.1.37)
Orthology
K01599  
uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
gem  Geobacter sp. M21
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GM21_0015 (hemE)
Enzymes [BR:gem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     GM21_0015 (hemE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
22944..23963
Genome map
AA seq 339 aa AA seqDB search
MNTRFLDACWGKPVDTVPVWLMRQAGRYLPDYMRVRSKCTFLELCKTPELATEVTVQPVD
ILGVDAAILFSDILTPIEPMGMELDFTPGPVFAKPIRTMADVEALKIPKMETDVPYVLDA
VKLLRKELAAKVPLIGFGGAPFTLACYMVEGKGSKDFAALKKMMYADPEVYAALMEKITT
MDMEYLNAQIKAGAQAIQIFDTWGGMLSPADYERYVLPYTQRLINGLDRTNIPVIHFVKG
AGTMLEIVKQAGGDVMGLDWHVNLGKARDILGDMAVQGNLDPTVLFAPNEIIEREVKRVL
DENAGRPGLIFNLGHGILPTVPPEKAIFMVDCVHRLSRK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaatactcgatttttagacgcatgttgggggaagccggttgacacggtgccggtctgg
ctgatgcgccaggcgggacgttatctccccgactacatgcgcgttcgctccaaatgcacc
ttcctggaactgtgcaagaccccggaactggcgaccgaggtaacggtccagccggtggac
atcctcggcgtcgatgcagcgatcctcttctccgacatcctcaccccgatcgagccgatg
gggatggaactcgacttcacccccggccccgtcttcgccaagccgatccgcaccatggcc
gacgtcgaggcgctcaagatcccgaagatggagaccgacgtcccctacgtgctggacgct
gtcaagctgctccgcaaggaactcgccgccaaggtgccgctgatcggcttcgggggcgcg
ccgttcaccctggcctgctacatggtcgagggtaaagggtccaaggacttcgccgcgctg
aagaagatgatgtacgccgaccccgaggtctacgcggcgctgatggaaaagatcaccacc
atggacatggagtacctgaacgcgcagatcaaggcgggcgcgcaggcgatccagatcttc
gacacctggggcggcatgctctccccggccgactacgagcgctacgtcctcccctacacc
cagcgcctcatcaacggcctggaccgcaccaacatcccggtgatccacttcgtcaagggc
gcagggaccatgctggagatcgtgaagcaggccggcggcgacgtcatgggcctcgactgg
cacgtgaacctcggcaaggcccgcgacatcctgggcgacatggcggtgcaggggaacctc
gacccgaccgtgctcttcgctcccaacgagatcatcgagcgcgaggtgaagagggtgctg
gacgaaaacgccggcaggcccggtctcatcttcaacctgggacacggcatcctcccgacc
gtcccgccggaaaaagcgatcttcatggtcgactgcgtgcaccggctgtcgaggaaatag

DBGET integrated database retrieval system