KEGG   Geobacter sp. M21: GM21_0019Help
Entry
GM21_0019         CDS       T00933                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gem  Geobacter sp. M21
Brite
Enzymes [BR:gem01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     GM21_0019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(26549..27586)
Genome map
AA seq 345 aa AA seqDB search
MKAKWFILLLPLLPGCVDATAKETMSKAQATFKPIPAQAPAIKGNEATKAKVDLGKKLFF
DPRLSTSQLISCNTCHDVGLGGADLQETSVGHGWQRGPRNAPTVFNAVYNVAQFWDGRAK
DLQTQAKGPVQASVEMNSNPELVVRTLKSIPGYPALFEAAFPGYSDPVTFDNMAKAIEVF
EATLVTPDAPFDRFLNGEASALSAREQAGLGVFMEKGCAACHGGINIGGAAYYPFGVREV
PAAEIRPESDTGRFKVTNTASDKYVFRAPSLRNVAITQPYFHSGKVWSLRESVVVMGSAQ
LGMKLNETEVNDTVAFMKSLTGRQPNMDYPLLPPSSDQTPHPQLK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgaaatggttcatactgctcttgccgctgcttcccggatgcgtcgatgccacc
gccaaggaaaccatgtccaaggcccaggccaccttcaagcccatcccggcgcaggcacca
gccatcaaggggaacgaggcgaccaaggccaaggtcgacttgggcaagaaactcttcttc
gatccccgtctctccacctcgcaactcatcagctgcaacacctgccatgacgtaggcctc
gggggcgccgacctccaggaaacctccgtcggccatgggtggcagagaggcccccgcaac
gcccctaccgttttcaacgccgtctacaacgtcgcccagttctgggacggcagggccaag
gacctgcagacccaggccaaggggccggtgcaggcgtccgtggagatgaacagcaacccc
gagctggtggtgagaaccctgaagagcatcccgggatacccagctctcttcgaggcggcc
ttccccgggtacagcgatccagtcaccttcgacaacatggcgaaggcgattgaggtgttc
gaggcgacactggtgactccggatgccccgttcgaccgcttcctcaacggagaggccagc
gctctaagcgcgcgggaacaggctggtttgggtgtcttcatggagaagggttgcgccgcc
tgccacgggggaatcaacatcggcggtgccgcctactaccccttcggcgtccgtgaggtc
ccggctgcagagatccgccccgagagcgacacgggtcgtttcaaggtgaccaataccgcc
agcgacaagtacgttttccgggcgccgtcgctcaggaacgtcgcgatcacccagccttat
ttccattccggaaaggtgtggagcctcagggagtcggtggtggtgatggggtccgcgcaa
ctgggaatgaaactgaacgagacggaagtgaacgacacggtcgcattcatgaagagcctg
acgggaagacagccgaatatggattaccccctgcttccgccgagttcggaccagaccccg
catccgcagctaaagtga

DBGET integrated database retrieval system