KEGG   Geobacter sp. M21: GM21_0410Help
Entry
GM21_0410         CDS       T00933                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gem  Geobacter sp. M21
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GM21_0410
Enzymes [BR:gem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     GM21_0410
Exosome [BR:gem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GM21_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
485707..486726
Genome map
AA seq 339 aa AA seqDB search
MFYPLYRARRIRGKEVFRNMVRETSLSANDLIYPMFSAFGKGIKKEISSMPGIYQQSIEN
IVEEAQEVYELGVPAVILFGIPEQKDAMGSDAYSDTGIIQETIRAIKKSVPKLAVITDVC
MCEYTDHGHCGVIKNGDVDNDETLELLAREALSHAQAGADMVAPSDMMDGRVAAIRESLD
NNGFNQIPLMSYAVKYASGYYGPFREAAESTPQFGDRRSYQMDPANRLEAIREARMDVEE
GADILMVKPGLPYLDIVREVRNEFNLPTAVYNVSGEYSMIKAAAKMGWIDEDRVIMETMM
SFKRAGADLILTYHSKEVAKLLRKGYEADIKDRCGCGCR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttctacccactgtacagagcgagaaggatccggggcaaagaagtcttcagaaacatg
gtcagggagacctcgctttccgccaatgacctcatatacccgatgttttccgccttcggc
aaggggatcaagaaagagatctcctccatgcccggcatctaccagcagtccatcgagaac
atcgtagaggaggcccaggaggtttacgagctgggcgttcccgccgtcatcctcttcggc
atccccgagcagaaggacgccatggggagcgacgcctactccgacaccggcatcatccag
gagaccattcgcgccatcaagaaatccgtaccgaagcttgccgtcatcaccgacgtctgc
atgtgcgagtacaccgatcacggccactgcggcgtgatcaaaaacggcgacgtcgacaac
gacgagaccctggaactgctcgccagggaagccctttcccacgcccaggccggcgccgac
atggttgccccatccgacatgatggacgggcgcgtcgccgccatccgcgagtctttggac
aacaacggcttcaaccagatcccgctgatgagctacgccgtcaagtacgcttccgggtac
tacggccccttcagggaagccgccgagtccaccccgcagttcggcgaccgtcgttcctac
cagatggatccggctaaccggctcgaagccatccgcgaagcccgtatggacgtcgaagaa
ggcgccgacatcctcatggtgaagcccggccttccctacctcgacatcgtgcgcgaggtg
aggaacgagttcaacctcccgaccgccgtgtacaacgtctccggtgagtacagcatgatc
aaggccgccgccaagatgggttggatcgacgaagaccgtgtcatcatggagaccatgatg
tccttcaagcgtgccggtgccgacctgatcctgacctatcactccaaagaagtagccaag
ctgttgaggaaagggtacgaagccgacatcaaggaccgctgcggctgcggctgcaggtaa

DBGET integrated database retrieval system