KEGG   Geobacter sp. M21: GM21_0502Help
Entry
GM21_0502         CDS       T00933                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K03587  
cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
gem  Geobacter sp. M21
Pathway
Peptidoglycan biosynthesis
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GM21_0502
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    GM21_0502
Enzymes [BR:gem01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     GM21_0502
Peptidoglycan biosynthesis and degradation proteins [BR:gem01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   GM21_0502
Chromosome [BR:gem03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    GM21_0502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
616143..618107
Genome map
AA seq 654 aa AA seqDB search
MIEKKEKWARVRMRFVALLFAVVFVATAGRAFYLQVLNNDRLVKLAEKQHQRIVALTPAR
GAIYDRTNAPFAVSIEMDSCYAETRNMDNIPQEAAQLAPLLGYGAQELEAKLKGAKNFVW
LARRIPPEQARKVKALGLEGVGFVKESKRFYPNSQVAAHVVGFTGIDPGGLEGVEKKYDA
TILGNTGFLVTERDALGRDIALKKGSEGKSGSKGNNVVLTLDKNVQYIAEKELANAVVKN
GAKAGIAIVMEPDTGRVLAMANYPSFNPNSFADYEQAALRNRAIADSFEPGSTFKIFLVA
SALEAGVIRPGDMFNCENGSYRMFGRTIHDTHKYGALSVPQILKYSSNIGAAKIGSRLGP
ERLYAALTGFGFGEKSSIDLPGEASGMLRPQSKWYGIDLATISFGQGVTTTALQITNAVS
VVANGGNLMKPYLVDRIVDDNGVVLQQFAPQVKRRIISPETAKTVARMLEGVVVEGGTGT
GAAVEGYRVAGKTGTAQKVEGRGYSASKRTASFVGFVPLNKPRLAIMVVIDEPTTSSYGG
VVAAPAFSAIAQQTLCYLNVPPDKNAVAKKKGAAPEKSAPKPESVAEGGSVEGGEAGAMP
NFQGMSMRQVLKVMEKRGLNVKLQGSGRAVEQNPAPGSRITTQDQVWVRFVPSA
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagaaaaaggagaaatgggccagagtccggatgcgtttcgtggccctcttgttc
gcggtcgtcttcgttgctaccgcgggccgtgccttttacctccaggtgctcaacaacgac
cggctggtgaagctcgcggagaaacagcaccaaaggatcgtggcgctcacgcctgcccgc
ggcgccatctacgacaggaccaacgccccgttcgccgtctcgatcgagatggattcctgc
tacgcggagacgcgcaacatggataacatccctcaggaggcggcgcagttggcgcctctt
ttggggtacggcgcgcaggagctggaggcgaagcttaagggggcgaagaattttgtgtgg
ctcgcgcggcgcatcccgccggagcaggcccggaaggtgaaggcgctggggcttgagggg
gtcggcttcgtcaaggaaagcaagcgcttctaccccaattcccaagtggcagcccacgtg
gtgggattcaccgggatcgatcccggcggcctggagggggtggagaagaagtacgacgcc
accatcctcggcaacacgggattcctggtcaccgagcgcgacgccctcgggcgcgacata
gcactcaagaaagggagcgagggcaaaagcggttccaaggggaacaacgtcgtcctcacc
ctggataagaacgttcagtacatagcggagaaggagctggccaacgcggtggtgaaaaac
ggcgccaaggccggcatagccatcgtgatggaacccgacaccgggcgggtcctggccatg
gccaattacccctccttcaatccgaacagctttgccgactacgagcaggcggcgcttcga
aaccgcgccatcgcagacagcttcgagcccggctccaccttcaagatcttcctggtagct
tccgcactggaggcgggggtgatcaggccgggcgacatgttcaactgcgaaaacggcagc
tacagaatgttcggcaggaccattcacgacacgcacaagtacggggcgctcagcgtgccc
cagatcctcaagtactccagcaacatcggcgccgccaagatcggcagccggctggggccg
gaaaggctctatgccgcgctcaccggtttcggcttcggcgagaagagcagcatcgatctt
ccgggggaggcgtccgggatgctgcggccgcagtcgaagtggtacggcatcgatctcgcc
accatctcgttcggccagggggtgacgaccacggcgctgcagatcaccaacgcggtgtcg
gtagtcgccaacggcggcaacctgatgaagccgtacctggtggataggattgtcgacgac
aacggcgtggtgctgcagcagttcgcaccccaggttaaaaggcgcatcatttcgccggag
acggcgaagacggtggcccgcatgctggagggggtcgtggtggaggggggaacaggcacc
ggcgcagcggtcgaagggtatcgcgtcgcggggaagaccgggaccgcccagaaggttgag
gggcgcggctactcggccagcaagcgcaccgcctccttcgtcggtttcgtacccctgaac
aagccccggctcgccatcatggtcgtgatcgacgagccgaccacgagttcctacggcggg
gtggtggcggccccggccttcagcgccatagcgcagcagaccctctgctacctgaacgtg
ccgccggacaagaatgccgttgccaagaagaaaggcgcggcacccgagaaaagcgcgccc
aagccggagtctgtggccgagggggggagcgtcgaggggggggaagccggcgccatgccg
aacttccaggggatgagcatgcggcaggtgctcaaggtgatggaaaagcgcggtctcaac
gtcaagctgcagggaagcggcagggcggtcgagcagaacccggcgcccgggagccgcatc
accacgcaggatcaggtttgggtcaggttcgtcccttcggcctga

DBGET integrated database retrieval system