KEGG   Geobacter sp. M21: GM21_0502Help
Entry
GM21_0502         CDS       T00933                                 

Definition
peptidoglycan glycosyltransferase (EC:2.4.1.129)
Orthology
K03587  
cell division protein FtsI (penicillin-binding protein 3)
Organism
gem  Geobacter sp. M21
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GM21_0502
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    GM21_0502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
616143..618107
Genome map
AA seq 654 aa AA seqDB search
MIEKKEKWARVRMRFVALLFAVVFVATAGRAFYLQVLNNDRLVKLAEKQHQRIVALTPAR
GAIYDRTNAPFAVSIEMDSCYAETRNMDNIPQEAAQLAPLLGYGAQELEAKLKGAKNFVW
LARRIPPEQARKVKALGLEGVGFVKESKRFYPNSQVAAHVVGFTGIDPGGLEGVEKKYDA
TILGNTGFLVTERDALGRDIALKKGSEGKSGSKGNNVVLTLDKNVQYIAEKELANAVVKN
GAKAGIAIVMEPDTGRVLAMANYPSFNPNSFADYEQAALRNRAIADSFEPGSTFKIFLVA
SALEAGVIRPGDMFNCENGSYRMFGRTIHDTHKYGALSVPQILKYSSNIGAAKIGSRLGP
ERLYAALTGFGFGEKSSIDLPGEASGMLRPQSKWYGIDLATISFGQGVTTTALQITNAVS
VVANGGNLMKPYLVDRIVDDNGVVLQQFAPQVKRRIISPETAKTVARMLEGVVVEGGTGT
GAAVEGYRVAGKTGTAQKVEGRGYSASKRTASFVGFVPLNKPRLAIMVVIDEPTTSSYGG
VVAAPAFSAIAQQTLCYLNVPPDKNAVAKKKGAAPEKSAPKPESVAEGGSVEGGEAGAMP
NFQGMSMRQVLKVMEKRGLNVKLQGSGRAVEQNPAPGSRITTQDQVWVRFVPSA
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagaaaaaggagaaatgggccagagtccggatgcgtttcgtggccctcttgttc
gcggtcgtcttcgttgctaccgcgggccgtgccttttacctccaggtgctcaacaacgac
cggctggtgaagctcgcggagaaacagcaccaaaggatcgtggcgctcacgcctgcccgc
ggcgccatctacgacaggaccaacgccccgttcgccgtctcgatcgagatggattcctgc
tacgcggagacgcgcaacatggataacatccctcaggaggcggcgcagttggcgcctctt
ttggggtacggcgcgcaggagctggaggcgaagcttaagggggcgaagaattttgtgtgg
ctcgcgcggcgcatcccgccggagcaggcccggaaggtgaaggcgctggggcttgagggg
gtcggcttcgtcaaggaaagcaagcgcttctaccccaattcccaagtggcagcccacgtg
gtgggattcaccgggatcgatcccggcggcctggagggggtggagaagaagtacgacgcc
accatcctcggcaacacgggattcctggtcaccgagcgcgacgccctcgggcgcgacata
gcactcaagaaagggagcgagggcaaaagcggttccaaggggaacaacgtcgtcctcacc
ctggataagaacgttcagtacatagcggagaaggagctggccaacgcggtggtgaaaaac
ggcgccaaggccggcatagccatcgtgatggaacccgacaccgggcgggtcctggccatg
gccaattacccctccttcaatccgaacagctttgccgactacgagcaggcggcgcttcga
aaccgcgccatcgcagacagcttcgagcccggctccaccttcaagatcttcctggtagct
tccgcactggaggcgggggtgatcaggccgggcgacatgttcaactgcgaaaacggcagc
tacagaatgttcggcaggaccattcacgacacgcacaagtacggggcgctcagcgtgccc
cagatcctcaagtactccagcaacatcggcgccgccaagatcggcagccggctggggccg
gaaaggctctatgccgcgctcaccggtttcggcttcggcgagaagagcagcatcgatctt
ccgggggaggcgtccgggatgctgcggccgcagtcgaagtggtacggcatcgatctcgcc
accatctcgttcggccagggggtgacgaccacggcgctgcagatcaccaacgcggtgtcg
gtagtcgccaacggcggcaacctgatgaagccgtacctggtggataggattgtcgacgac
aacggcgtggtgctgcagcagttcgcaccccaggttaaaaggcgcatcatttcgccggag
acggcgaagacggtggcccgcatgctggagggggtcgtggtggaggggggaacaggcacc
ggcgcagcggtcgaagggtatcgcgtcgcggggaagaccgggaccgcccagaaggttgag
gggcgcggctactcggccagcaagcgcaccgcctccttcgtcggtttcgtacccctgaac
aagccccggctcgccatcatggtcgtgatcgacgagccgaccacgagttcctacggcggg
gtggtggcggccccggccttcagcgccatagcgcagcagaccctctgctacctgaacgtg
ccgccggacaagaatgccgttgccaagaagaaaggcgcggcacccgagaaaagcgcgccc
aagccggagtctgtggccgagggggggagcgtcgaggggggggaagccggcgccatgccg
aacttccaggggatgagcatgcggcaggtgctcaaggtgatggaaaagcgcggtctcaac
gtcaagctgcagggaagcggcagggcggtcgagcagaacccggcgcccgggagccgcatc
accacgcaggatcaggtttgggtcaggttcgtcccttcggcctga

DBGET integrated database retrieval system