KEGG   Geobacter sp. M21: GM21_0557Help
Entry
GM21_0557         CDS       T00933                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gem  Geobacter sp. M21
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GM21_0557
Enzymes [BR:gem01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     GM21_0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(682916..683914)
Genome map
AA seq 332 aa AA seqDB search
MNSKDIPMVPNRKASLPTVYGDTPSFLGVPVLDYKKPAAGYDVMVAGVPWEGTVTWGSFT
GCELAPRSIRHASARYGGFLPEYEIDLFDHLTLGDIGDIPIHPNDPAETMRNVHAAMQRI
YRNQSIPFVLGGDHSFTPEIIRALADGDEGKIGIIHLDAHLDNAKSFGSDQFARCGPIHR
ISQIPQVRKESIVHLGIRGPRNSPTQYEYAQSMGARVITTREVRGRGMSAVTEEAIRIAH
HETRHVFVTICSDCIDAGYNPGGPADFNGLLPSELLPALHQIGASGISGLDYVEVYPGQD
PQGYSSHLAAWAMIYALSGMAQRKRDRPGPDR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaaagacatcccgatggttcccaacaggaaggcctcgctccccaccgtctat
ggcgacactccctcttttctcggagtacccgttctggattacaagaaacctgcagcaggc
tacgacgtgatggtcgccggggtcccctgggaagggaccgtcacctggggctccttcaca
gggtgcgagctcgctcccaggagcatccggcacgcctcggcgcgttacggcggattcctc
cccgagtacgagatcgacctgttcgaccacctgacgctcggcgacatcggggatataccg
atacaccccaatgaccccgccgagacgatgcgcaacgtgcacgccgccatgcagcggatc
taccgcaaccagagcatccccttcgtgctgggaggcgaccactccttcaccccggagatc
atcagggcgctcgcggacggagacgagggcaagatcggcatcatccacctggacgcacac
ctcgacaacgccaagtccttcggcagcgaccagttcgcccgctgcggcccgatccacagg
atctcccagatcccgcaggtccgcaaagagagcatcgtccatctgggtatccgcggcccg
aggaactccccgacacagtacgagtatgcccaaagcatgggcgcgcgcgtcatcaccacc
agggaagtcaggggaagggggatgagcgccgtcaccgaggaggcgatacggatcgcgcac
cacgaaaccaggcacgtcttcgtcaccatctgcagcgactgcatcgatgccgggtacaac
ccgggggggccggccgatttcaacgggctgctccccagcgagcttttgccggcgctgcac
caaatcggagcctcgggcatcagcggcctagattacgtcgaggtttatccggggcaggac
ccgcagggatattcctcgcacctggctgcctgggcgatgatctacgcgctctcgggtatg
gcgcagcgaaagcgcgaccggccgggaccggaccggtaa

DBGET integrated database retrieval system