KEGG   Geobacter sp. M21: GM21_0717Help
Entry
GM21_0717         CDS       T00933                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gem  Geobacter sp. M21
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GM21_0717
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GM21_0717
  Amino acid metabolism
   00310 Lysine degradation
    GM21_0717
Enzymes [BR:gem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GM21_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
859798..861057
Genome map
AA seq 419 aa AA seqDB search
MEIKVPAVGESVYEAVIARWLKKSGEVVAKDEPLCEIETDKVTLEVTSEADGVLTTLAAE
GETVKIGAVIATIDARGAEAAPSAGSAASAKSAPSGAPAAEAAQAKAVPKGTAPPISPSG
RKLARELGVEPQDVKGTGRGGRVTREDLLKVEGGEPAPVEAEPILAAQPAPTAKPERAPA
PPPAEEGERVVRKPMTQIRKRIAERLVSVRQQTAMLTTFNEADLSQVMLLRRKYGEHFQK
RHGVKLGLMSFFVRACCEALAQFPEVNAKIDGDDMVYHNFCDIGVAVGSERGLVVPVLRG
AESLTLAGIEQQIAQYAEKVRQNRIAIADLEGGTFTISNGGVYGSMLSTPILNPPQSGVL
GMHAIQPRAVVVEGEIVVRPMMYLALSYDHRIVDGQGAVGFLKLVKEYIEEPEELLLEG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaaggttcccgcggtgggcgagtcggtctatgaggcggtgatcgccaggtgg
ctcaagaagtcgggcgaggtcgtagcgaaggacgagccgctttgcgagattgagacggac
aaggtgaccctggaggtgacctcggaggcggacggcgtgttgaccacgctggcggccgag
ggggagacggtgaagatcggcgcggtgatcgccaccatagacgcccgcggcgcagaggcc
gcaccctccgcagggagcgccgcttcggctaagtccgcgccttcaggcgccccagccgcc
gaggccgcgcaggccaaagctgtccccaagggtacggcgcctcccatctccccttccggg
cgcaagctggcccgcgagctgggcgtcgagccccaggacgtcaagggtaccgggcgcgga
gggcgcgtgaccagggaggatctcttgaaggtggaggggggcgagcccgctcccgtcgag
gccgaacccatcctggcggcgcagcctgcgccgaccgcaaagcccgaacgggcacccgcc
ccccctccagccgaagaaggggagcgtgtggtacgcaagccgatgacgcagatcaggaag
cggatcgcggagcggctggtctcggttaggcagcagaccgcgatgctcaccaccttcaac
gaggcggacctgagccaggtgatgctgctgcgccggaagtacggcgaacatttccagaag
cgacacggcgtgaagctggggctcatgtcctttttcgtccgcgcctgctgcgaggccctc
gcccagtttcccgaagtgaacgcgaagatcgatggcgacgacatggtctaccacaacttc
tgcgacatcggcgtcgccgtcgggagcgaaagggggctggtggtgccggtcttgaggggc
gccgagtcgcttacgcttgcggggatagagcagcagatcgcgcagtacgccgagaaggtg
cgccaaaaccgaatcgccatcgccgacctggagggggggaccttcaccatttccaacggc
ggggtctacggttccatgctctccaccccgatcctcaacccgccgcagagcggggtgctg
gggatgcacgcgatacagccgcgcgccgtggttgtcgaaggcgagatcgtggtccgtccc
atgatgtacctggcgctttcctacgaccaccggatcgtggacgggcagggggcggtaggg
ttcctgaagctggtcaaggagtacatcgaggagccggaggagttgctgctcgaagggtag

DBGET integrated database retrieval system