KEGG   Geobacter sp. M21: GM21_0779Help
Entry
GM21_0779         CDS       T00933                                 

Definition
(GenBank) peptidase M42 family protein
Organism
gem  Geobacter sp. M21
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
927761..928831
Genome map
AA seq 356 aa AA seqDB search
MRDASFEFLQQLLAAPSPSGYEQPAQRVFRSYIEPFCQVATDVMGNVFGMIQGAGNNRPR
VMVVGHSDEIGLQVRYLDDNGFIYFSAIGGVDPHITPGMRVHVHTAKGKLNGVIGKRPIH
LIEPKERDTVIKLDAQYIDIGAANKKEALEWVRVGDPITFDSNLERLFGDRVSSRGLDDK
AGSFVVAEVLRRVSELPDQLPIDLYGVSSVQEEVGLRGGTTSSYSVNPDVGICVEVDFAT
DQPDVDKKHNGEVGLGKGPILPRGANINPVLFDLLSDTATGNGIAVQYTGIARATGTDAN
VMQISRGGVATALVKIPLRYMHTPVETLSLADLDGAVELIVASLSKMGHKDAFIPM
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacgcatctttcgaattcctgcagcaattgctggcggcgcccagcccctcgggg
tacgagcagcctgcccagcgggtcttccgctcctacatagagccgttttgccaggtggcg
accgacgtcatgggtaacgtcttcggcatgattcagggcgccggaaataaccgcccccgc
gtcatggtcgtggggcactccgacgagatcgggctccaggtccgctacctggacgacaac
ggtttcatctatttctccgccatcggcggggtcgatccccacataacgcccgggatgcgg
gtccacgtccacaccgcgaaggggaagctgaacggcgtcatcggcaagcgccccatccac
ctgatcgagcccaaagagcgcgacaccgtcattaagctggacgcccagtacatagacatc
ggcgccgccaacaagaaagaggccctggagtgggtgcgggtaggcgatcccatcaccttc
gacagcaatctggagcggctcttcggggaccgcgtcagttcgcgtggtctcgacgacaag
gcaggcagcttcgttgtcgccgaggtgctccgtcgcgtctccgagcttccggaccagctc
cccatcgacctctacggcgtatcctccgtccaggaggaggttgggcttcgcggcggcacc
accagcagctactcggtgaaccccgacgtcggcatctgcgtcgaggtggatttcgccacc
gaccagcccgacgtggacaaaaagcacaacggcgaagtaggtctaggcaaagggccgatc
cttccccgcggcgccaacatcaaccccgtcctcttcgacctcctctccgacaccgcgacc
ggcaacggcatcgccgtgcagtacaccggcatcgcccgggcgaccggcaccgacgcgaac
gtaatgcagatttcgcgcgggggcgtcgccaccgctttggtgaagatcccgctgcgctac
atgcacaccccggtggagaccctgtcgcttgccgacctggacggggcggtcgagctgatt
gtcgcctcgctctccaagatggggcacaaggacgcgttcattccgatgtga

DBGET integrated database retrieval system