KEGG   Geobacter sp. M21: GM21_0779Help
Entry
GM21_0779         CDS       T00933                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gem  Geobacter sp. M21
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gem00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
927761..928831
Genome map
AA seq 356 aa AA seqDB search
MRDASFEFLQQLLAAPSPSGYEQPAQRVFRSYIEPFCQVATDVMGNVFGMIQGAGNNRPR
VMVVGHSDEIGLQVRYLDDNGFIYFSAIGGVDPHITPGMRVHVHTAKGKLNGVIGKRPIH
LIEPKERDTVIKLDAQYIDIGAANKKEALEWVRVGDPITFDSNLERLFGDRVSSRGLDDK
AGSFVVAEVLRRVSELPDQLPIDLYGVSSVQEEVGLRGGTTSSYSVNPDVGICVEVDFAT
DQPDVDKKHNGEVGLGKGPILPRGANINPVLFDLLSDTATGNGIAVQYTGIARATGTDAN
VMQISRGGVATALVKIPLRYMHTPVETLSLADLDGAVELIVASLSKMGHKDAFIPM
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacgcatctttcgaattcctgcagcaattgctggcggcgcccagcccctcgggg
tacgagcagcctgcccagcgggtcttccgctcctacatagagccgttttgccaggtggcg
accgacgtcatgggtaacgtcttcggcatgattcagggcgccggaaataaccgcccccgc
gtcatggtcgtggggcactccgacgagatcgggctccaggtccgctacctggacgacaac
ggtttcatctatttctccgccatcggcggggtcgatccccacataacgcccgggatgcgg
gtccacgtccacaccgcgaaggggaagctgaacggcgtcatcggcaagcgccccatccac
ctgatcgagcccaaagagcgcgacaccgtcattaagctggacgcccagtacatagacatc
ggcgccgccaacaagaaagaggccctggagtgggtgcgggtaggcgatcccatcaccttc
gacagcaatctggagcggctcttcggggaccgcgtcagttcgcgtggtctcgacgacaag
gcaggcagcttcgttgtcgccgaggtgctccgtcgcgtctccgagcttccggaccagctc
cccatcgacctctacggcgtatcctccgtccaggaggaggttgggcttcgcggcggcacc
accagcagctactcggtgaaccccgacgtcggcatctgcgtcgaggtggatttcgccacc
gaccagcccgacgtggacaaaaagcacaacggcgaagtaggtctaggcaaagggccgatc
cttccccgcggcgccaacatcaaccccgtcctcttcgacctcctctccgacaccgcgacc
ggcaacggcatcgccgtgcagtacaccggcatcgcccgggcgaccggcaccgacgcgaac
gtaatgcagatttcgcgcgggggcgtcgccaccgctttggtgaagatcccgctgcgctac
atgcacaccccggtggagaccctgtcgcttgccgacctggacggggcggtcgagctgatt
gtcgcctcgctctccaagatggggcacaaggacgcgttcattccgatgtga

DBGET integrated database retrieval system