KEGG   Geobacter sp. M21: GM21_0870Help
Entry
GM21_0870         CDS       T00933                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gem  Geobacter sp. M21
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gem00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1035743..1037230
Genome map
AA seq 495 aa AA seqDB search
MEYLLSIDQGTTSSRATLYAASGETLATVSRPLVQHYPNPGWVEHAAQEIWEGQLACIAE
AIAKAGIAPAKVAGIGITNQRETTVVWERETGEPLHRAIVWQDRRTAELTESLKEQGLEA
MVRERTGLLLDPYFSASKLSWLLDRVDGLRRRAERGEVCFGTIDSWLMFKLSGGKSHLTD
ISNASRTMLFNINTLEWDEELLRLFRIPRGMLPEVRGSAAGFGHTSAQVAGAEIPIAGVA
GDQQAALFGQGCFAPGMAKATFGTGAFVVMNSGARLGVGDGVLSTIAWQLPGEAVQYALE
GSIFIAGAAVQWLQEGLGLIASAREVEALAASVSDSAGVYFVPALSGLGTPYWDPYARGV
IAGLTRGSTKAHLARAALEAIAFQTLDAIRAMEKASGIALKELRVDGGAAADNLLLQIQA
DLLGVPVLRPRCTESTSLGAAFLAGIGAGVLDTSAIAAQWALDRRFEPQMERNLREELHR
GWQKCVRLSLGWEKN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggaatacctcttgtccatagatcaggggaccaccagcagcagggcgaccctctatgcc
gcctcgggcgaaactctcgcgaccgtgtctcggccgcttgtgcagcactacccgaacccg
gggtgggtggagcacgccgcgcaggagatctgggaggggcaacttgcctgcatcgccgag
gccatcgccaaagcagggatcgcgcccgccaaggtagccggcatcggcatcaccaatcag
cgcgagaccaccgtggtctgggagcgggagaccggagagccgctgcaccgcgccatcgtc
tggcaggaccggcgcaccgcggagctgaccgagtcgctcaaagagcaggggctcgaggcg
atggttcgcgagcggactgggcttttgctggacccttacttctcggcgagcaagctctcc
tggctcctggaccgggtggacggcctgcgccggcgggcggagaggggagaggtctgcttc
ggtaccatcgacagttggctcatgttcaaactgagcggcggcaaaagccacctgaccgac
atctccaacgcaagccgtaccatgctcttcaacatcaacacccttgagtgggatgaagaa
ttgctgcggcttttccgcatcccgcgcgggatgcttcccgaggtcagggggagcgctgcg
gggttcggccacacctcggcccaggtggccggcgccgagatacccatagccggagtggct
ggcgaccagcaggcggcgcttttcgggcaggggtgcttcgcccccggcatggccaaggcc
accttcggtaccggcgcgttcgtggtcatgaacagcggtgcgcgccttggggttggcgac
ggagttctctccaccatcgcctggcagcttcccggcgaggcagtgcagtacgcgctggag
ggctccatattcatcgccggtgcggcggtgcagtggctgcaggagggattggggctgatc
gcgagtgcgcgggaggtggaggcgctcgccgcgagcgtatcggactcggccggggtttat
ttcgttccggcgctctccggccttgggaccccctactgggacccctacgcgaggggggtg
atagccgggcttaccagggggagcacgaaggcgcatctcgcgcgcgccgcgctggaggcg
atcgccttccagacgctcgacgccatccgcgccatggagaaggcgagcggcatcgcgctc
aaggaactccgcgttgacggaggggcggctgccgacaacctgctgttgcagatccaggca
gaccttttgggtgtcccggtgcttcgcccgcgttgcaccgagagcacctcgcttggggcg
gcgtttttggccggtatcggggccggggtgctggatacctccgccatagcggcgcagtgg
gcgctggaccgccgcttcgagccgcaaatggagcgaaatctgcgcgaggaattgcacagg
ggatggcagaagtgcgtgcggctttcgcttgggtgggaaaagaactaa

DBGET integrated database retrieval system