KEGG   Geobacter sp. M21: GM21_0885Help
Entry
GM21_0885         CDS       T00933                                 

Definition
squalene-hopene cyclase (EC:5.4.99.17)
Orthology
K06045  
squalene-hopene/tetraprenyl-beta-curcumene cyclase [EC:5.4.99.17 4.2.1.129]
Organism
gem  Geobacter sp. M21
Pathway
Sesquiterpenoid and triterpenoid biosynthesis
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    GM21_0885
Enzymes [BR:gem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.129  squalene---hopanol cyclase
     GM21_0885
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.17  squalene---hopene cyclase
     GM21_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1054597..1056639)
Genome map
AA seq 680 aa AA seqDB search
MTSPFKHPISNALTSFNGNFAEPEQCVEQQTGAKVHHLPASIWKRKMGKAKSPLDVAIEG
SRDFFFQEQLPKGYWWAELESNVTITAEYIMLFHFLGLVDRERQRKMSNYLLSKQTEEGF
WPIYYGGPGDLSTTIEAYFALKLSGYPADHPALAKARAFILEQGGVVKSRVFTKIFLALF
GEFEWQGVPSMPVELNLLPDWAYINIYEFSSWARATIVPLSVVMHSRPVRRVPPSARVQE
LFVRQPTAADYSFAKNDGIFTWENFFLGLDRVLKVYEKSPLRPFKNMALAKAEEWVLEHQ
EPTGDWGGIQPAMLNAVLALNVLGYQNDHPAVEQGLRALANFCIETEDQLVLQSCVSPVW
DTALALKALLDAGVPPDHPSLVKGAQWLLDKEVTRPGDWRVKSPALEPGGWAFEFLNDWY
PDVDDSGFVMIALKGIQVKDRKSMDAAIKRGINWCLGMQSKNGGWGAFDKDNTRHVLNKI
PFADLEALIDPPTADLTGRMLELMGTFNYPITLPAAQRAIEFLKKNQEPEGPWWGRWGVN
YLYGTWSVLCGLAAIGEDMDQPYIRKAVNWIKSRQNIDGGWGETCQSYHDRTLAGVGEST
PSQTGWALLGLLAAGEMHSATVVRGVQYLISTQNSDGTWDEQQYTGTGFPKYFMIKYHIY
RNCFPLMALGTYRTLTRTQP
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcccctttcaagcaccccatatcaaacgcactcacctcattcaacggtaacttt
gcagagccggagcaatgcgtagagcaacagacaggagcaaaggtgcatcaccttcctgct
tcaatctggaagcggaaaatgggcaaggcaaagagccccttggatgtagccattgaggga
agccgcgacttcttctttcaggagcagctacccaaaggttattggtgggcagaactcgaa
tccaatgtcaccatcaccgccgaatacatcatgctgttccatttccttgggctggttgat
cgtgagcgccagcgcaagatgtcgaactacctactgtcgaaacagactgaagaaggtttc
tggcccatctattacggcggaccgggcgatctctccaccaccatagaggcctacttcgcc
ctgaagctctccgggtacccggcggaccacccggccctggcgaaggcgcgcgccttcatc
ctggagcaggggggggtcgtcaagagccgcgtcttcaccaagatcttccttgcgctcttc
ggcgagttcgagtggcagggggtcccgagcatgccggtggagctgaacctccttcccgac
tgggcctacatcaacatttacgaattctccagttgggccagggcgaccatcgtcccgctt
tccgtggtgatgcacagccgcccggtgcgcagggtccccccttccgcgcgggtgcaggaa
ctcttcgtgcggcagcccaccgcggcggactacagcttcgccaagaacgacggcatcttc
acctgggagaattttttcctaggtcttgaccgcgtgctcaaggtgtacgagaagagcccg
ctgcgcccgttcaagaacatggcgctggccaaggcggaggagtgggtgctggagcaccag
gagccgaccggcgactggggagggatccagccggccatgctgaacgccgtcctcgcgctc
aacgtgctggggtaccagaacgaccaccccgcggtggagcaggggttgagggcgctggcg
aacttctgcatcgaaaccgaggaccagttggtgctgcaatcctgcgtgtcgcctgtgtgg
gacacggcgctggcgttaaaggcgctgctggacgcgggcgttcctcccgaccacccctcc
ctggtgaagggggcccagtggcttctggacaaggaggtgacccggccaggcgactggcgc
gtcaagtccccagcccttgaaccgggcggatgggccttcgagttcctgaacgactggtac
ccggacgtggacgactccggcttcgtcatgatcgccctgaaggggatccaggtgaaggac
cgcaagtccatggacgccgccatcaagcgcggcatcaactggtgcctggggatgcagagc
aagaacggcggctggggggcgttcgacaaggacaacaccaggcacgtcctgaacaagatc
ccctttgccgacctggaggcgctcatcgatccgcccaccgcggacctgaccggccgtatg
ctggagctgatgggaaccttcaactaccccatcaccttgccggccgcgcagcgcgccatc
gaattcctgaagaagaaccaggagccggaggggccctggtgggggcgctggggggtgaac
tacctttacggcacctggtccgtgctttgcgggctggccgccataggcgaggacatggat
cagccttacatccgcaaggcggtgaactggatcaagtcgcgccagaacatcgacggaggc
tggggcgagacctgccagtcgtaccacgaccggaccctggcaggcgtcggcgagagcacc
ccttcccagacggggtgggcgcttttagggctcttggcggccggcgagatgcactcggcg
accgtggtgcgcggggtgcagtacctgatctccacccagaacagcgacgggacctgggac
gaacagcagtacaccgggaccgggttccccaagtacttcatgatcaagtaccacatctac
cgcaactgcttcccgctcatggctctgggaacctaccgcaccttgacgaggacgcagccg
tga

DBGET integrated database retrieval system