KEGG   Geobacter sp. M21: GM21_0895Help
Entry
GM21_0895         CDS       T00933                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gem  Geobacter sp. M21
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GM21_0895
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GM21_0895
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GM21_0895
Enzymes [BR:gem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GM21_0895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1068503..1069306
Genome map
AA seq 267 aa AA seqDB search
MSRISDRFASLKERGEKALVTFVTAGDPDLATTEKVVLELERAGADLVELGVPFSDPMAD
GPTIQLSSDRALASGTTLPAILELVSRLREKTQVPIVLMGYFNPIFAYGSERFAFDAAQA
GVDALLVVDLPPEEAAELKGATDSCGLDLIFLLTPTSDSSRVAMVARQGSGFIYYVSVTG
VTGARSAVADDLAARVTEVRGALELPLVVGFGISTPEQAGEVAQAADGVVVGSALVKYFE
KYQGAELLEQLGGFVSALKQGVLKGSR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggatttcagatagatttgccagcctgaaagagcggggggaaaaggcgctcgtt
accttcgtcaccgcgggcgacccggatctggcgaccacggaaaaggtggtgcttgaactc
gagcgggcaggggccgacttggtcgagttgggagtccccttctccgatcccatggccgac
ggcccgaccatccagctctcctcggaccgagccctggcctccggcaccacgcttccggcg
atactggagcttgtatcgaggctcagggaaaagacccaggtccccatcgtgctgatgggt
tatttcaaccccatcttcgcctacggttccgagcgctttgccttcgacgcggcccaggcg
ggtgtcgacgccctgctggtggtggatctcccccccgaggaggccgcggagctgaaagga
gccaccgacagctgcgggctcgacctcatcttcctcctcaccccgacctcagacagctcc
agggtcgctatggtcgcgcgccagggaagcggcttcatctactacgtctccgtcaccggc
gtcaccggcgcgcgcagcgcggtcgccgacgacctggcggcccgggtcaccgaggtgcgc
ggggcgcttgagctgccgctcgtggtcggcttcggcatctccaccccggagcaggcgggg
gaggtggcccaggcggccgacggcgtggtggtgggaagcgcgctggtgaagtacttcgag
aagtaccagggggccgaactcctggaacagttggggggcttcgtctcggcgctaaaacaa
ggagtgctgaaggggtccaggtag

DBGET integrated database retrieval system