KEGG   Geobacter sp. M21: GM21_1031Help
Entry
GM21_1031         CDS       T00933                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
gem  Geobacter sp. M21
Pathway
gem00010  Glycolysis / Gluconeogenesis
gem00030  Pentose phosphate pathway
gem00051  Fructose and mannose metabolism
gem00052  Galactose metabolism
gem00680  Methane metabolism
gem01100  Metabolic pathways
gem01110  Biosynthesis of secondary metabolites
gem01120  Microbial metabolism in diverse environments
gem01130  Biosynthesis of antibiotics
gem01200  Carbon metabolism
gem01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM21_1031
   00030 Pentose phosphate pathway
    GM21_1031
   00051 Fructose and mannose metabolism
    GM21_1031
   00052 Galactose metabolism
    GM21_1031
  Energy metabolism
   00680 Methane metabolism
    GM21_1031
Enzymes [BR:gem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GM21_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ACT17092
JGI: GM21_1031
UniProt: C6E2E6
Position
1208962..1209897
Genome map
AA seq 311 aa AA seqDB search
MKTIVTITMNPAIDKSATVDHVVAERKLYCSEPLFEPGGGGINVSRAVRKLGGESLALYP
SGGHSGQTLRLLLEQEGVAHRLVAVAGWTRENLIVLESATGQQYRFGMPGPDLSATEWQA
CLEQIFAGGAKPDYIVASGSLPPGVPPDFYARVARLGKQHGARVVVDASGEPMRLALREG
VFLIKPNIREFREMIGEGGEDEAKVLALAKKIVLDGESEVVVISLGAAGVLMVSDSGVER
LHPPTVPIISKVGAGDSMVAGMVLSLARGNGLRDAVRFGVAAGTAAVMTPGTELCRREDA
ERLYRQMLPGE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatcgtgaccataaccatgaatcctgccatcgataagagtgcgacggtggat
catgtggtggcggaaagaaagctttattgcagcgagcccctgttcgagccggggggaggc
gggatcaacgtgtcgcgggcagtgcggaagcttgggggggagtccctggctctttatccg
tcgggagggcacagcggacagacgctgcgcttgctgctcgaacaggaaggggtggcgcac
cgtctggttgcggtcgccggttggaccagggagaacctgatcgtcttggagtccgcaaca
gggcagcagtaccgcttcgggatgcccgggccggatctctccgccacggagtggcaggct
tgcctggaacagatctttgccggcggagccaaacccgattacatcgtggcaagcggcagt
ctccctccgggcgtgccgccggacttctatgccagggtagcgcgccttggaaagcagcat
ggcgcccgggtggtggtggacgcttcgggcgagcccatgcgcctggcgctgcgcgaggga
gtcttcctgatcaagccgaacatccgggagtttcgggagatgataggcgaggggggggaa
gacgaagctaaggtgcttgcgcttgccaagaagatcgtcctcgatggggagagcgaggtg
gtggtgatctcgctgggcgcggccggggtcctcatggtgtcggactcgggcgtggagcgg
ctgcatccccccacggttcccattatcagcaaggtcggcgccggtgactccatggtggcc
ggtatggtgttgagccttgcgcgggggaacgggctccgtgacgccgtccgtttcggggtg
gctgccgggaccgcagcggtgatgacgcccggaacggaactctgccgccgggaggatgcc
gagaggctgtaccggcagatgcttccgggcgaatag

DBGET integrated database retrieval system