KEGG   Geobacter sp. M21: GM21_1031Help
Entry
GM21_1031         CDS       T00933                                 

Definition
1-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
gem  Geobacter sp. M21
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GM21_1031
   01230 Biosynthesis of amino acids
    GM21_1031
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM21_1031
   00030 Pentose phosphate pathway
    GM21_1031
   00051 Fructose and mannose metabolism
    GM21_1031
   00052 Galactose metabolism
    GM21_1031
  Energy metabolism
   00680 Methane metabolism
    GM21_1031
Enzymes [BR:gem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GM21_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1208962..1209897
Genome map
AA seq 311 aa AA seqDB search
MKTIVTITMNPAIDKSATVDHVVAERKLYCSEPLFEPGGGGINVSRAVRKLGGESLALYP
SGGHSGQTLRLLLEQEGVAHRLVAVAGWTRENLIVLESATGQQYRFGMPGPDLSATEWQA
CLEQIFAGGAKPDYIVASGSLPPGVPPDFYARVARLGKQHGARVVVDASGEPMRLALREG
VFLIKPNIREFREMIGEGGEDEAKVLALAKKIVLDGESEVVVISLGAAGVLMVSDSGVER
LHPPTVPIISKVGAGDSMVAGMVLSLARGNGLRDAVRFGVAAGTAAVMTPGTELCRREDA
ERLYRQMLPGE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatcgtgaccataaccatgaatcctgccatcgataagagtgcgacggtggat
catgtggtggcggaaagaaagctttattgcagcgagcccctgttcgagccggggggaggc
gggatcaacgtgtcgcgggcagtgcggaagcttgggggggagtccctggctctttatccg
tcgggagggcacagcggacagacgctgcgcttgctgctcgaacaggaaggggtggcgcac
cgtctggttgcggtcgccggttggaccagggagaacctgatcgtcttggagtccgcaaca
gggcagcagtaccgcttcgggatgcccgggccggatctctccgccacggagtggcaggct
tgcctggaacagatctttgccggcggagccaaacccgattacatcgtggcaagcggcagt
ctccctccgggcgtgccgccggacttctatgccagggtagcgcgccttggaaagcagcat
ggcgcccgggtggtggtggacgcttcgggcgagcccatgcgcctggcgctgcgcgaggga
gtcttcctgatcaagccgaacatccgggagtttcgggagatgataggcgaggggggggaa
gacgaagctaaggtgcttgcgcttgccaagaagatcgtcctcgatggggagagcgaggtg
gtggtgatctcgctgggcgcggccggggtcctcatggtgtcggactcgggcgtggagcgg
ctgcatccccccacggttcccattatcagcaaggtcggcgccggtgactccatggtggcc
ggtatggtgttgagccttgcgcgggggaacgggctccgtgacgccgtccgtttcggggtg
gctgccgggaccgcagcggtgatgacgcccggaacggaactctgccgccgggaggatgcc
gagaggctgtaccggcagatgcttccgggcgaatag

DBGET integrated database retrieval system