KEGG   Geobacter sp. M21: GM21_1040Help
Entry
GM21_1040         CDS       T00933                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gem  Geobacter sp. M21
Pathway
gem00020  Citrate cycle (TCA cycle)
gem00640  Propanoate metabolism
gem00660  C5-Branched dibasic acid metabolism
gem01100  Metabolic pathways
gem01110  Biosynthesis of secondary metabolites
gem01120  Microbial metabolism in diverse environments
gem01130  Biosynthesis of antibiotics
gem01200  Carbon metabolism
Module
gem_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gem_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GM21_1040
   00640 Propanoate metabolism
    GM21_1040
   00660 C5-Branched dibasic acid metabolism
    GM21_1040
Enzymes [BR:gem01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GM21_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACT17101
JGI: GM21_1040
UniProt: C6E2F5
Position
1224406..1225575
Genome map
AA seq 389 aa AA seqDB search
MNVHEYQAKAILRKFGVPVPDGHVCYNGASAREWAKRLGEGPWVVKAQIHAGGRGKGGGV
KLARTANEVQMIARDMLGMTLRTHQTGPEGKVVHRVLVECGCNIGSELYVSLLVDRATSR
VTVMASTEGGMDIEEVAAKTPEKIFTEAVDPLVGLTPFQCRKIAFSLGLRGKLTGKAVKV
FTSLYNTFIATDCSLLEINPLVVTAEGELIALDAKFGFDDNALFRHLQIGDMRDFDEEDA
HEIEASQHDLSYISLSGNIGCLVNGAGLAMATMDIIKHYGGDPANFLDVGGGATIERVTE
AFKIILSDKNVKGILVNIFGGIMKCDVIATGVIEAARQVGIQVPLVVRLEGTNVEVGKRL
LAESGLNIVAADGMADGAQKIVRAVAAAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtccacgagtaccaggctaaagcaattctgcgcaaattcggcgtgccggttccg
gatggccacgtttgctacaacggcgccagtgccagggaatgggccaaaaggctcggcgag
ggaccttgggtggtgaaggcccagatccatgccggggggcgcggcaaggggggaggggtc
aaactggcccgcaccgcgaacgaggtgcagatgatcgcccgcgacatgctcggcatgacc
ttgaggacgcaccagaccgggccggaagggaaagtggtgcaccgggtcctggtcgagtgc
ggctgcaacatcggcagcgagctgtacgtgagcctcttggtggaccgcgccacctcccgc
gtcacggtcatggcctccaccgagggggggatggacatcgaagaagtggccgcgaagacc
ccggagaagatcttcaccgaggcggtcgatccgctggtggggctgactccctttcagtgc
cgaaagatcgccttcagcttggggctcaggggaaagctcacggggaaggccgtcaaggtc
ttcacctccctctacaacaccttcatcgccaccgactgctcgcttttggagataaacccg
ctggtcgtcaccgctgaaggggagctgatcgcgctggacgccaaattcggcttcgacgac
aacgcgcttttcaggcacctgcagataggcgacatgcgtgacttcgacgaggaggacgcg
cacgagatcgaggcctcccagcacgacctctcctacatctctctatccggcaacataggc
tgcctcgttaacggcgccggtctcgccatggccaccatggacataatcaagcactacggc
ggcgacccggcgaacttcctcgacgttgggggcggggccaccatcgagcgcgtcaccgag
gccttcaagatcatcctctcggataagaacgtgaaggggatcctggtcaacatcttcggc
gggatcatgaagtgcgacgtcatcgccaccggggtcatcgaagcggcgcggcaggtcggg
atccaggtgccgctcgtcgtcaggctggaaggaaccaacgtggaagtcggcaaaaggctt
ttggcggaaagcggattgaacatagtggctgccgacggcatggccgacggggcgcagaaa
atagtgcgggccgtggcggccgcagcctaa

DBGET integrated database retrieval system