KEGG   Geobacter sp. M21: GM21_1446Help
Entry
GM21_1446         CDS       T00933                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gem  Geobacter sp. M21
Pathway
gem00900  Terpenoid backbone biosynthesis
gem01100  Metabolic pathways
gem01110  Biosynthesis of secondary metabolites
gem01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GM21_1446
Enzymes [BR:gem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     GM21_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACT17503
JGI: GM21_1446
UniProt: C6E4K5
Position
1703167..1704009
Genome map
AA seq 280 aa AA seqDB search
MKKLQLLAPAKVNYRLDVLGKRPDGYHELRMIMQRVDLCDEIEIALTDVPGIRVTCGRKG
VPDGPGNIAWRAADALLKLSGKEVGIDISIAKKIPVGAGLGGGSSDAATVLMGVNELLGL
GLTDERLMEIGVKLGADVPFFIFKKPALAEGIGDRLTALEEVPSLWVVLVNPGIHVSTAW
VYQNLRLTTGNPITIIPRSYSSLDEVCALLSNDLEPVTCGRFPLVSEVKEVLLAAGARGS
LMSGSGSTVFGLFDDENAARTAAAEIEKTRGWFAAAVRTI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaactgcaactgctggcgccggccaaggtcaactaccggctggacgtactgggc
aagaggcccgacggctatcacgagctgcgcatgatcatgcagagggtcgatctctgcgac
gagattgagatcgccctcaccgatgtgcccggaatccgggtcacctgcggcaggaaaggg
gtgccagacgggccggggaacatagcctggcgtgccgccgacgccctgttgaagctttcc
ggcaaggaagtcggcatcgacatctccatcgccaagaagataccggtaggggcagggctt
gggggggggagcagcgacgccgccacggtgctcatgggggtgaacgagctcctcggattg
gggcttacagacgagcggttgatggagatcggcgtcaagctgggtgccgacgtcccgttc
ttcattttcaaaaagcccgcccttgccgaggggataggcgacaggctcaccgcactggaa
gaggtcccctcactctgggtcgttctggtgaacccggggatacacgtctccaccgcctgg
gtctatcaaaatttaaggttgacaaccgggaatcccatcactataatcccgcgttcatac
agcagcctcgatgaggtctgcgcgctcctttccaacgatctggagccggtcacctgcggg
agatttcccctggtgagcgaggtgaaagaagtactgttggcggccggtgcccgcgggtcg
ttgatgtcgggaagcggttccaccgttttcggacttttcgacgacgagaatgcggcgcga
acggctgcagctgagattgagaaaacgcgtggctggtttgcagccgccgtcaggaccatc
tag

DBGET integrated database retrieval system