KEGG   Geobacter sp. M21: GM21_1556Help
Entry
GM21_1556         CDS       T00933                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gem  Geobacter sp. M21
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1815086..1815706
Genome map
AA seq 206 aa AA seqDB search
MVAELVKRGITDQRVLGAMQEIPRHIFVEEAMSAQAYSDGSLPIGEKQTISQPYIVAKMT
QLLALTGREKVLELGTGSGYQAAVLATLADRVCTVERIRPLALKARKALDSLRLLNVNLK
IGDGTEGWPEEAPFDAILVTAGAPHLPDCLVRQLAPGGRLVIPVGDRIDQKLLLVTKGMD
GSVATEECDDCRFVRLIGKNGWNDEQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtggctgagctggtaaagcgtggcatcaccgaccagcgggtgcttggcgccatgcag
gaaataccgagacacatattcgtagaagaggccatgtcggcccaggcctacagcgacggg
tcgctgccgataggcgaaaagcagaccatctcgcagccgtacatagtggcgaagatgacg
cagcttttggcgctgaccgggcgcgagaaggtgctggagctgggaaccggctcaggctac
caggcagccgtcctagccaccctcgccgaccgggtctgcacagtagagcgcatacggccg
ctggcgctcaaggcgcgcaaggctctcgacagcctcaggcttttgaacgtgaaccttaaa
ataggggacggaaccgaagggtggcccgaggaggcgcctttcgacgccatcctcgttacc
gcgggcgccccgcatcttcccgactgcctggtccggcaactggcccccggcggcaggctg
gtgattccggtgggcgataggatcgaccagaagctcttgctggtgacaaagggaatggac
ggcagcgtggccaccgaagagtgcgacgattgccgcttcgtgaggcttattggaaaaaac
ggctggaatgacgagcagtag

DBGET integrated database retrieval system