KEGG   Geobacter sp. M21: GM21_1769Help
Entry
GM21_1769         CDS       T00933                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gem  Geobacter sp. M21
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GM21_1769
   01230 Biosynthesis of amino acids
    GM21_1769
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM21_1769
   00030 Pentose phosphate pathway
    GM21_1769
   00051 Fructose and mannose metabolism
    GM21_1769
   00052 Galactose metabolism
    GM21_1769
  Energy metabolism
   00680 Methane metabolism
    GM21_1769
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GM21_1769
Enzymes [BR:gem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GM21_1769
Protein phosphatases and associated proteins [BR:gem01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GM21_1769
Messenger RNA biogenesis [BR:gem03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GM21_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2056333..2057292)
Genome map
AA seq 319 aa AA seqDB search
MKKIGILTSGGDCSGMNAAIRAATRTALGHGVQVVGFRKGYAGLLKGDFLDMQTKDVAGI
LHRGGTFLQSARSEEFRTVLGREKAVRHLEEFGVEGLVVIGGDGSLNGALALHRMGVPVI
GIPASIDNDIPFTDMSLGVDTALNNIIYAVDCIKDTASSHDRAFVIEVMGRNSGYLASMA
AIATGAEYAIVPEVECDVADLSNQLRHRWEEGRSNAIIILAEGAGRAQNIADNIKDAIGF
ETRVTVLGHYQRGGAPSVFDRLLGSRLGHAAVENLLAGQMGKMVGLCCNAIVPTLLETVV
VSEKRQQDELHEMSLILGI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagggatactcaccagcggcggagactgctccggcatgaacgcggccatc
agggccgcgacaaggaccgccctggggcacggggtgcaggtggtcggcttccgcaagggg
tacgcggggcttttgaagggggacttcctcgatatgcagacgaaagacgtggcggggatc
ctgcacagggggggtaccttcctgcaatcggccagaagcgaggagttccgcaccgtcttg
ggaagggagaaagcggtccggcacttggaggagttcggggtcgaggggctggtcgtcatc
ggtggggacggctccttgaacggcgcgctggcgctgcaccgcatgggggtgccggtgatc
ggaatacctgcgagcatcgacaacgacatccccttcaccgatatgtcgctcggggtggac
acggcgctcaacaacatcatctacgcggtcgactgcatcaaggatacggcgagctcgcac
gaccgagccttcgtcatagaggttatggggagaaattccgggtatctcgccagcatggcg
gccatcgccaccggcgccgagtacgccatagtcccagaggtcgagtgcgacgtggcggat
ctgtccaaccagctcaggcaccgctgggaggaagggcgcagcaacgccatcatcatcctg
gccgaaggggccgggcgcgcgcagaacatcgccgacaacatcaaggacgccatcggtttc
gagacccgggtcaccgtgctcggccactaccagagggggggcgccccttcggtcttcgac
cggcttttgggaagcaggctcgggcacgcggcggtggaaaacctcctggccgggcagatg
ggaaagatggtggggctttgctgcaacgcgatcgtgccgactcttttggagacggtggtg
gtaagcgagaagaggcagcaagacgagctgcacgagatgtcgttgatccttggcatctag

DBGET integrated database retrieval system