KEGG   Geobacter sp. M21: GM21_1882Help
Entry
GM21_1882         CDS       T00933                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gem  Geobacter sp. M21
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GM21_1882 (tpiA)
   01230 Biosynthesis of amino acids
    GM21_1882 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM21_1882 (tpiA)
   00051 Fructose and mannose metabolism
    GM21_1882 (tpiA)
   00562 Inositol phosphate metabolism
    GM21_1882 (tpiA)
Enzymes [BR:gem01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GM21_1882 (tpiA)
Exosome [BR:gem04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GM21_1882 (tpiA)
  Exosomal proteins of bladder cancer cells
   GM21_1882 (tpiA)
  Exosomal proteins of melanoma cells
   GM21_1882 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2186281..2187036)
Genome map
AA seq 251 aa AA seqDB search
MRKPVIAGNWKLFKTKNEALALIEELAPLVSGVDNVEIVVAPVFTVLPTLPAALAGTGIS
LAAQDVFWEEEGAFTGEVSPRMLLDAGASHVIIGHSERRQYFGETEETVNKKVKAALKGA
LVPIVCIGETLEAREAGDTFKVLEGQLKGGLEGLTGTQFAPVILAYEPVWAIGTGKVASD
DQAQEAHAFIRGVIAGLFGKSAADKVRILYGGSVKPENVKGLMSRTDIDGALVGGASLKG
ASFASIVRYGE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagccggtcatagcaggcaactggaaactgttcaagactaagaacgaggcgctc
gcactgatagaagaactggcacctctggtttccggcgtggacaacgtcgagatcgtggtg
gcaccggtgttcaccgtgctccccaccctccccgcagcgctcgccggcaccggcatcagc
ctcgcggcacaggacgttttctgggaagaagaaggcgcctttaccggcgaggtttcgccg
cgcatgcttcttgacgccggcgcaagccacgtcatcatcggccactccgaacgcaggcag
tacttcggcgagaccgaggaaacggtcaacaagaaggtcaaggccgccctcaagggggcg
ctggtccctatcgtgtgcatcggcgagaccctggaagcgcgcgaagccggcgataccttc
aaggtgctggaaggccagctgaagggagggctcgaggggctgaccggaacgcagttcgca
ccggtcatcttagcctacgagccggtctgggccatcggcaccggcaaggtcgcctccgac
gatcaggcgcaggaggcgcatgccttcattcgcggcgtcatcgccgggctcttcggcaag
tcggcggcggataaagtgaggattctctacggcggctccgtgaagccggaaaacgtgaaa
ggactcatgtcgcgcacagacatagacggcgcgcttgtgggaggcgcaagtctcaagggc
gcatcttttgcctcaatcgtgcgctacggtgaataa

DBGET integrated database retrieval system